KEGG   Butyrivibrio proteoclasticus: bpr_III208Help
Entry
bpr_III208        CDS       T01292                                 

Gene name
bhx3C
Definition
beta-N-acetylhexosaminidase Bhx3C
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    bpr_III208 (bhx3C)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    bpr_III208 (bhx3C)
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     bpr_III208 (bhx3C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:234345..236345
Genome map
AA seq 666 aa AA seqDB search
MKSKFSKILSVLLTLTLLTGTYTLTGCSSVKGEAKVTRIMEQMSLDEKISQMIIPAIRTW
NEENVTDLSAVPQLREALRRHQYGGIILFGSNITGNEQVTRLLHDLQDNNSQIEGVATHI
PYLTPVDEEGGIVIRLTSGTRMTGNMAIGATTDSVKNAEETGRILGEELAALGFNADFAP
DIDVNNNPSNPVIGTRSFSDDPDLVSKLGKAYAKGLSENNIIATYKHFPGHGDTSVDSHI
GTPSVEKTYDEIKKTELVPFEAAIKDGAEMIMTAHITYPLIDEPKTFGDGVTQGFFPATM
SKKIITDILRTDMGYDGVVVTDALEMDAIDDAGLVPGAKGSAEYSINIATEVINSGVDIL
LLPMDLKNAQAATFYDDYIAGIGAKVTSGEISQDRIDESVQRILTLKAKHGMLDDSDAAN
SDIEKNVSDSISIVGSKNHHDAEMNMARQAITVVKNDDNALPVSNETKNIFILGRQNADA
TTLQFAVDELKKGSFIAPDATINIDYYYDSSADVKLHYTDDMKDKISASDVVIGFSYASG
NGALDKSGPQYIGITSAINDIHAAGGKFILVSENLPYDAAIYKDADAIVLAYMGSALGTD
PTDKTDSGSGLKATNANIVAAIETVFGSNKAQGHLPVNVPDVTENSDGTLSYSSTYLYER
GFGITD
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaagttttccaagattttatcagtattactaactctgactcttttaacagga
acttataccctgactggctgctcttctgtcaagggtgaagccaaagtcacccggataatg
gagcagatgtctcttgatgaaaagatctcgcaaatgataatcccggcaatccgaacctgg
aacgaagaaaatgttactgatctatctgctgttccacagctaagagaggctctaaggcgc
caccagtacggcggcataatcctgtttggttccaatatcaccggaaatgagcaggtgaca
agactattacacgaccttcaggacaataacagtcagatagaaggtgtggcgacgcatatt
ccttacctcacaccggttgacgaagaaggcggaatcgttataaggcttacttccggaacc
cgtatgaccggaaacatggcaatcggagcaactacagattctgttaaaaatgcagaggaa
accggcaggattctcggagaagagcttgctgctctcggctttaatgctgattttgcacct
gatatagatgtaaataataatccttcaaacccggttatcggcacaaggtctttttctgat
gatccagatcttgtctctaagcttggaaaagcttatgccaagggactttcagagaacaat
atcatagctacatataagcatttcccgggtcacggtgacacaagcgttgacagtcatata
ggcactccatccgttgaaaagacctatgatgagatcaaaaagactgaacttgtaccattt
gaagcagcgatcaaagatggcgctgagatgataatgacagctcacataacctatcctctt
atcgacgaacccaaaacctttggagatggtgtgacccaaggctttttcccggcaaccatg
tccaaaaagataattacagacatattaagaacagatatgggctatgacggcgttgttgtt
accgatgcacttgaaatggatgcaatcgatgacgcgggccttgtacccggagcaaagggc
tctgcagaatacagcataaatattgccacggaagtcataaacagtggtgtagacatactc
ctactaccaatggatcttaaaaatgctcaggcagcaactttctatgatgactatattgct
ggtattggagctaaggttacttccggagaaatcagccaggatagaattgacgaaagcgta
cagcgcattcttacacttaaagccaagcatggaatgttggacgattctgatgcagcaaat
tctgatatagaaaaaaatgtctcagacagcatatctattgttggttccaagaatcaccat
gatgctgaaatgaatatggcaagacaggctattacagtagtaaaaaatgatgataatgct
cttccggtttcaaacgaaaccaaaaacatcttcattcttggcaggcaaaatgctgatgcg
accactttgcagttcgcagttgatgagcttaaaaaaggctctttcattgctccggatgcc
acaataaacattgactattactatgattcatcagcagacgtcaagcttcactatacagat
gatatgaaagataaaatatcggcttccgatgtagtaattggtttttcctacgcttcgggc
aatggtgccctcgataagagcggcccccagtatattggaataacaagtgctatcaatgat
atccatgctgccggcggaaaattcatacttgtaagtgaaaatcttccatatgacgctgca
atttataaggatgcagatgcaattgtacttgcctacatgggttctgcccttggcacagat
cctactgataaaaccgacagcggatccggtttaaaagcaacaaacgccaacatcgttgct
gccatcgagactgtttttggatcaaataaagcccagggccatcttcctgttaatgtccct
gacgttacagaaaacagtgatggtaccctgagctatagttctacatatctatatgagaga
ggttttggtattacagactga

DBGET integrated database retrieval system