KEGG   Butyrivibrio proteoclasticus: bpr_III208Help
Entry
bpr_III208        CDS       T01292                                 

Gene name
bhx3C
Definition
beta-N-acetylhexosaminidase Bhx3C
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpb00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bpb00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:234345..236345
Genome map
AA seq 666 aa AA seqDB search
MKSKFSKILSVLLTLTLLTGTYTLTGCSSVKGEAKVTRIMEQMSLDEKISQMIIPAIRTW
NEENVTDLSAVPQLREALRRHQYGGIILFGSNITGNEQVTRLLHDLQDNNSQIEGVATHI
PYLTPVDEEGGIVIRLTSGTRMTGNMAIGATTDSVKNAEETGRILGEELAALGFNADFAP
DIDVNNNPSNPVIGTRSFSDDPDLVSKLGKAYAKGLSENNIIATYKHFPGHGDTSVDSHI
GTPSVEKTYDEIKKTELVPFEAAIKDGAEMIMTAHITYPLIDEPKTFGDGVTQGFFPATM
SKKIITDILRTDMGYDGVVVTDALEMDAIDDAGLVPGAKGSAEYSINIATEVINSGVDIL
LLPMDLKNAQAATFYDDYIAGIGAKVTSGEISQDRIDESVQRILTLKAKHGMLDDSDAAN
SDIEKNVSDSISIVGSKNHHDAEMNMARQAITVVKNDDNALPVSNETKNIFILGRQNADA
TTLQFAVDELKKGSFIAPDATINIDYYYDSSADVKLHYTDDMKDKISASDVVIGFSYASG
NGALDKSGPQYIGITSAINDIHAAGGKFILVSENLPYDAAIYKDADAIVLAYMGSALGTD
PTDKTDSGSGLKATNANIVAAIETVFGSNKAQGHLPVNVPDVTENSDGTLSYSSTYLYER
GFGITD
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaagttttccaagattttatcagtattactaactctgactcttttaacagga
acttataccctgactggctgctcttctgtcaagggtgaagccaaagtcacccggataatg
gagcagatgtctcttgatgaaaagatctcgcaaatgataatcccggcaatccgaacctgg
aacgaagaaaatgttactgatctatctgctgttccacagctaagagaggctctaaggcgc
caccagtacggcggcataatcctgtttggttccaatatcaccggaaatgagcaggtgaca
agactattacacgaccttcaggacaataacagtcagatagaaggtgtggcgacgcatatt
ccttacctcacaccggttgacgaagaaggcggaatcgttataaggcttacttccggaacc
cgtatgaccggaaacatggcaatcggagcaactacagattctgttaaaaatgcagaggaa
accggcaggattctcggagaagagcttgctgctctcggctttaatgctgattttgcacct
gatatagatgtaaataataatccttcaaacccggttatcggcacaaggtctttttctgat
gatccagatcttgtctctaagcttggaaaagcttatgccaagggactttcagagaacaat
atcatagctacatataagcatttcccgggtcacggtgacacaagcgttgacagtcatata
ggcactccatccgttgaaaagacctatgatgagatcaaaaagactgaacttgtaccattt
gaagcagcgatcaaagatggcgctgagatgataatgacagctcacataacctatcctctt
atcgacgaacccaaaacctttggagatggtgtgacccaaggctttttcccggcaaccatg
tccaaaaagataattacagacatattaagaacagatatgggctatgacggcgttgttgtt
accgatgcacttgaaatggatgcaatcgatgacgcgggccttgtacccggagcaaagggc
tctgcagaatacagcataaatattgccacggaagtcataaacagtggtgtagacatactc
ctactaccaatggatcttaaaaatgctcaggcagcaactttctatgatgactatattgct
ggtattggagctaaggttacttccggagaaatcagccaggatagaattgacgaaagcgta
cagcgcattcttacacttaaagccaagcatggaatgttggacgattctgatgcagcaaat
tctgatatagaaaaaaatgtctcagacagcatatctattgttggttccaagaatcaccat
gatgctgaaatgaatatggcaagacaggctattacagtagtaaaaaatgatgataatgct
cttccggtttcaaacgaaaccaaaaacatcttcattcttggcaggcaaaatgctgatgcg
accactttgcagttcgcagttgatgagcttaaaaaaggctctttcattgctccggatgcc
acaataaacattgactattactatgattcatcagcagacgtcaagcttcactatacagat
gatatgaaagataaaatatcggcttccgatgtagtaattggtttttcctacgcttcgggc
aatggtgccctcgataagagcggcccccagtatattggaataacaagtgctatcaatgat
atccatgctgccggcggaaaattcatacttgtaagtgaaaatcttccatatgacgctgca
atttataaggatgcagatgcaattgtacttgcctacatgggttctgcccttggcacagat
cctactgataaaaccgacagcggatccggtttaaaagcaacaaacgccaacatcgttgct
gccatcgagactgtttttggatcaaataaagcccagggccatcttcctgttaatgtccct
gacgttacagaaaacagtgatggtaccctgagctatagttctacatatctatatgagaga
ggttttggtattacagactga

DBGET integrated database retrieval system