KEGG   Bordetella pertussis CS: BPTD_0182Help
Entry
BPTD_0182         CDS       T01846                                 

Gene name
dcd
Definition
deoxycytidine triphosphate deaminase
Orthology
K01494  
dCTP deaminase [EC:3.5.4.13]
Organism
bpc  Bordetella pertussis CS
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BPTD_0182 (dcd)
Enzymes [BR:bpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.13  dCTP deaminase
     BPTD_0182 (dcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
188043..188606
Genome map
AA seq 187 aa AA seqDB search
MSIKSDRWIRRAAEAGMIEPFEPGQVRTAGGNRIVSYGTSSYGYDVRCADEFKIFTNINS
TIVDPKQFDEKSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGIIV
NVTPLEPEWEGHVTLEFSNTTPLPAKVYAGEGCAQMLFLESDEVCETSYRDRGGKYQGQR
GVTLPRT
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaaaagcgaccgctggatccgccgcgcggccgaagccggcatgatcgaaccc
ttcgagccgggccaggtccgcaccgcgggcggcaaccgcatcgtcagctacggcaccagc
agctacggctacgacgtgcgctgcgcggacgaattcaagatcttcaccaacatcaattcc
accatcgtcgatcccaagcagttcgacgagaagtcgttcgtcgacttcaagggcgatgtc
tgcatcatcccgcccaactcgttcgcgctggcgcgcacggtcgagtacttccgcatcccg
cgcagcgtgctgacgatctgcctgggcaagagcacctacgcgcgttgcggcatcatcgtc
aacgtcacgccgctcgaacccgaatgggaaggccacgtcacgctggagttctccaacacc
acgccgctgccggccaaggtctacgccggcgagggctgcgcccagatgctgttcctcgaa
agcgacgaggtgtgcgagacctcgtatcgcgaccgcggcggcaagtaccagggccagcgc
ggcgtcaccctgccgcgcacctga

DBGET integrated database retrieval system