KEGG   Bordetella pertussis CS: BPTD_0291Help
Entry
BPTD_0291         CDS       T01846                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bpc  Bordetella pertussis CS
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPTD_0291 (folK)
Enzymes [BR:bpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BPTD_0291 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
300926..301417
Genome map
AA seq 163 aa AA seqDB search
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFV
NAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPH
PRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagcccggcttccaccctggcatacgtcggcctgggagccagcctgggcgac
gcggccgccacgctgcgcagcgtgcttgccgaactggccgccgcgccaggcatcctcgcc
tgcaaggcttcgcgcctgtaccggacggcgcccgtcgaggcccagggccccgacttcgtc
aacgcggtcgccgcgctcgacaccacgctggcgccgctggacctgctggacctgttgcag
gcgctggaacagcgccatggccgcgagcggccctaccgcaatgcgccgcgcaccctggac
ctggacctgctgctgtatggcgaacaggccatcgaccatccccgcctgagcgtgccgcat
ccgcgcatgcatgaacgcgccttcgtgctggcgccgctgtgcgaactggtccccgccctg
cgcctggcgcaaggcgactgcgcggcgctgctggccgcgctggaagaccaggccatcgag
ccgctgcgctga

DBGET integrated database retrieval system