KEGG   Bordetella pertussis CS: BPTD_0547Help
Entry
BPTD_0547         CDS       T01846                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00220  Arginine biosynthesis
bpc00330  Arginine and proline metabolism
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01130  Biosynthesis of antibiotics
bpc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BPTD_0547
   00330 Arginine and proline metabolism
    BPTD_0547
Enzymes [BR:bpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BPTD_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEE66006
Position
complement(569924..570868)
Genome map
AA seq 314 aa AA seqDB search
MIAASFPHGVSLIGAPTDIGAGQRGASMGPEALRVAGLVRLLERRGLQVTDRGNLQGAPN
PWRPPANGYRHLNEVIGWNQLVHDAVSAELRQERLPILLGGDHSLAIGSISAVARYCRAS
GRKLRVLWLDAHADFNTNRLTPTGNVHGMPVACLCGNGPAALTSMAGRTPAIEPGWVRQI
GIRSVDEGERNLVYDAGLEVYDMRYLDEVGMRAVMEAALAGLDPQTHLHVSFDVDFLDPE
LAPGVGTTVPGGPTYREAQLCMEMIADTGLMRSRDIVELNPALDVRNKTAQVAVDLVESL
FGKSTLMRRRPGSA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctgcatcgttcccccacggggtcagcctgatcggcgcgcccaccgacatcggc
gcgggccagcgcggcgcttccatggggcccgaggccctgcgcgtggcgggcctggtgcgc
ctgctcgagcggcgcggcctgcaagtgaccgatcgcggcaacctgcagggcgcgcccaac
ccgtggcgcccgccggccaacggctaccggcacctcaacgaagtcatcggctggaaccag
ctcgtgcacgacgccgtcagcgccgagttgcgccaggagcgcctgcccatcctgctgggc
ggcgaccacagcctggccatcggctcgatcagcgcggtggcgcgctattgccgcgcgagt
ggccgcaagctgcgcgtgctgtggctggacgcgcacgccgacttcaataccaaccggctc
acgcccaccggcaacgtgcacggcatgccggtcgcctgcctgtgcggcaacggccccgcg
gcactgaccagcatggccggccgcacgccggccatcgaaccgggctgggtgcgccagatc
ggcatccgcagcgtggacgaaggcgaacgcaacctggtctacgacgccgggctggaggtc
tacgacatgcgctatctcgacgaggtcggcatgcgcgcggtgatggaggccgccctggcc
gggctggacccgcagacgcatttgcacgtcagcttcgacgtcgacttcctcgaccccgag
ctggcgccgggcgtgggcacgaccgtgcccggcggtcccacctatcgcgaagcccagctg
tgcatggaaatgatcgccgacaccggcctgatgcgctcgcgggacatcgtcgaactcaat
cccgcgctggacgtgcgcaacaagaccgcccaggtcgcggtggacctggtcgaaagcctg
ttcggcaaatccaccctgatgcgccggcgccccggcagcgcctga

DBGET integrated database retrieval system