KEGG   Bordetella pertussis CS: BPTD_0614Help
Entry
BPTD_0614         CDS       T01846                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00010  Glycolysis / Gluconeogenesis
bpc00260  Glycine, serine and threonine metabolism
bpc00680  Methane metabolism
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01120  Microbial metabolism in diverse environments
bpc01130  Biosynthesis of antibiotics
bpc01200  Carbon metabolism
bpc01230  Biosynthesis of amino acids
Module
bpc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPTD_0614 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BPTD_0614 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPTD_0614 (gpmA)
Enzymes [BR:bpc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BPTD_0614 (gpmA)
Membrane trafficking [BR:bpc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BPTD_0614 (gpmA)
Exosome [BR:bpc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BPTD_0614 (gpmA)
  Exosomal proteins of melanoma cells
   BPTD_0614 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEE66070
Position
635106..635858
Genome map
AA seq 250 aa AA seqDB search
MYKLVLMRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKREGYAFDLAYTSVLKR
AIRTLWIALDAMDAMYTPVGINWRLNERHYGQLQGLNKAETAAKYGDEQVLIWRRAYAIA
PEPLDLEDPRHPRFDGRYAKIPADQLPATECLKDTVARVLPFWNESIAPAIRAGRRVLVA
AHGNSLRALIKHLDNVSDDDIVGVNIPTGQPLVYELDEDLKPIRHYYLGDAAEIEAAMAA
VAAQGKAKKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaacttgttctgatgcgccacggcgaaagccagtggaacctggaaaaccgtttc
acgggctggaccgatgtggacctgaccgaaaccggccgcgagcaggcccgcaaggcgggc
gaattgctcaagcgcgagggttacgccttcgacctggcctatacctcggtgctcaagcgc
gccatccgcacgctctggatcgccctggacgccatggacgccatgtataccccggtgggc
atcaactggcgcctgaacgagcgccactacggccagctgcaaggcctgaacaaggccgag
accgccgccaagtacggcgacgagcaggtgctgatctggcgccgcgcctacgcgatcgcc
ccggagccgctggacctggaagatccgcgccacccgcgtttcgacggccgctacgccaag
atcccggccgaccagctgccggccaccgaatgcctgaaggatacggtggcgcgcgtgctg
ccgttctggaacgaatcgatcgccccggccatccgcgccggccgccgcgtcctggtggcc
gcgcatggcaacagcctgcgcgcgctgatcaagcacctcgacaatgtttccgatgatgac
atcgtgggcgtgaatattccgaccggccagcctctggtgtatgaattggatgaggacctg
aagccgattcgccactattatctgggcgatgccgccgagatcgaggcggcgatggctgcc
gtggcggcgcagggcaaggcgaaaaaggactga

DBGET integrated database retrieval system