KEGG   Bordetella pertussis CS: BPTD_0614Help
Entry
BPTD_0614         CDS       T01846                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpc  Bordetella pertussis CS
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPTD_0614 (gpmA)
   01230 Biosynthesis of amino acids
    BPTD_0614 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPTD_0614 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BPTD_0614 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPTD_0614 (gpmA)
Enzymes [BR:bpc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BPTD_0614 (gpmA)
Exosome [BR:bpc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BPTD_0614 (gpmA)
  Exosomal proteins of melanoma cells
   BPTD_0614 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
635106..635858
Genome map
AA seq 250 aa AA seqDB search
MYKLVLMRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKREGYAFDLAYTSVLKR
AIRTLWIALDAMDAMYTPVGINWRLNERHYGQLQGLNKAETAAKYGDEQVLIWRRAYAIA
PEPLDLEDPRHPRFDGRYAKIPADQLPATECLKDTVARVLPFWNESIAPAIRAGRRVLVA
AHGNSLRALIKHLDNVSDDDIVGVNIPTGQPLVYELDEDLKPIRHYYLGDAAEIEAAMAA
VAAQGKAKKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaacttgttctgatgcgccacggcgaaagccagtggaacctggaaaaccgtttc
acgggctggaccgatgtggacctgaccgaaaccggccgcgagcaggcccgcaaggcgggc
gaattgctcaagcgcgagggttacgccttcgacctggcctatacctcggtgctcaagcgc
gccatccgcacgctctggatcgccctggacgccatggacgccatgtataccccggtgggc
atcaactggcgcctgaacgagcgccactacggccagctgcaaggcctgaacaaggccgag
accgccgccaagtacggcgacgagcaggtgctgatctggcgccgcgcctacgcgatcgcc
ccggagccgctggacctggaagatccgcgccacccgcgtttcgacggccgctacgccaag
atcccggccgaccagctgccggccaccgaatgcctgaaggatacggtggcgcgcgtgctg
ccgttctggaacgaatcgatcgccccggccatccgcgccggccgccgcgtcctggtggcc
gcgcatggcaacagcctgcgcgcgctgatcaagcacctcgacaatgtttccgatgatgac
atcgtgggcgtgaatattccgaccggccagcctctggtgtatgaattggatgaggacctg
aagccgattcgccactattatctgggcgatgccgccgagatcgaggcggcgatggctgcc
gtggcggcgcagggcaaggcgaaaaaggactga

DBGET integrated database retrieval system