KEGG   Bordetella pertussis CS: BPTD_0800Help
Entry
BPTD_0800         CDS       T01846                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpc  Bordetella pertussis CS
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bpc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpc00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bpc00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bpc00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
847907..848653
Genome map
AA seq 248 aa AA seqDB search
MTTAENRARLVLGNWKMHGNLAENAALLAELRAADAAAHCEMGVCVPFPYLAQTAAALQG
SAIGWGAQDVSAHAKGAYTGEVAAPMLAEFGCRWVLVGHSERRTLHAESDQLVADKARAA
LEAGLTPVVCVGESLQEREGGNTLGVIERQLEPVLALGRDALVRMVLAYEPVWAIGTGRT
ASPEQAQEVHSAIRVALDGLQASQVRVLYGGSVKGANAASLFAMPDIDGGLVGGASLVAE
EFLRIAAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagctgagaatcgcgcccgcctggtgctgggcaactggaagatgcacggcaac
ctggccgagaacgccgccttgctggccgagttgcgcgccgccgatgccgccgcccattgc
gaaatgggggtgtgcgtgccgtttccgtacctggcccagaccgctgccgccttgcagggc
agcgccatcggctggggcgcgcaggatgtcagcgcgcacgccaagggcgcctacaccggc
gaagtcgccgcccccatgctggccgaattcggctgccgctgggtgctggtgggccactcc
gagcggcgcacgctgcatgccgagagcgaccagctggtggccgacaaggcccgcgccgcg
ctcgaggcaggcctgaccccggtggtttgcgtcggcgaatcgctgcaagagcgcgaaggc
ggcaacaccctgggcgtgatcgagcgccagctcgaacccgtcctggccctgggccgcgat
gccctggtccgcatggtcctcgcctacgaacccgtctgggccatcggcaccggccgtact
gccagccccgagcaggcgcaggaagtgcacagcgccatccgcgtggcgctcgacggcctg
caagccagccaggtgcgcgtgctgtacggcggcagcgtcaagggggccaacgccgccagc
ctgttcgccatgcccgacatcgacggcggcctggtgggcggggcctcgctcgtcgctgaa
gaattcctgcgcatcgccgcagcttaa

DBGET integrated database retrieval system