KEGG   Bordetella pertussis CS: BPTD_1026Help
Entry
BPTD_1026         CDS       T01846                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bpc  Bordetella pertussis CS
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bpc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1098043..1099095
Genome map
AA seq 350 aa AA seqDB search
MKKIKVLCVDDSALVRGLMTEIINSHPDMEVVATAPDPLVARELIKKHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDFVTKPKLGIRDGLIEYS
EVIADKIRAASRARLRALAPASHAAPLRLRSPFASSEKLVIVGASTGGTEAIREVLQPLP
ADSPAILITQHMLAGFTRSFAQRLDALCAVTVREASDGERVLPGHVYLAPGGETHMRLGR
SGANYVIGLQASEPVNRHRPSVDVLFHSAAEAAGGNAIGVILTGMGKDGAAGLLAMKRAG
ARTMAQDEASCVVFGMPREAIALGAADEVVPLADISERILTRLGDRGHRV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatcaaggtcttgtgcgtggatgattccgcgctggtgcgcggtctgatgacc
gagatcatcaacagccatccggacatggaggtggtcgcgaccgcgcccgatccgctggtg
gcgcgcgaactgatcaagaagcacaacccggacgtgctgacgctggatgtggaaatgccg
cgcatggacggcctggatttcctcgaaaagctgatgcggctgcggcccatgccggtggtg
atggtgtcgtcgctgaccgagcgcggcggcgagatcacgctgcgggcgctggaactgggc
gcgatcgatttcgtgaccaagcccaagctggggatccgcgacgggttgatcgagtattcc
gaggtgatcgcggacaagatccgcgccgcctcgcgcgcgcgcctgcgcgcgctggcgccg
gcgagccacgcggcgccgctgcgcctgcgcagtccgttcgccagctccgagaagctggtg
atcgtgggcgcatcgaccggcggcaccgaagcgatccgcgaggtgctgcagcccctgccg
gccgacagcccggcgatcctcatcacccagcacatgctggccggcttcacgcgctcgttc
gcgcagcgcctggacgcgctgtgcgcggtgaccgtgcgcgaagccagcgacggcgagcgg
gtgctgcctggccacgtgtacctggcgccgggcggcgagacgcatatgcgcctgggccgc
agcggcgccaactacgtgatcgggctgcaggccagcgagccggtcaaccggcaccgcccc
tcggtggacgtgctgttccattcggccgccgaggcggccggcggcaatgcgatcggggtg
atactgaccggcatgggtaaggatggcgcggccggcttgctggccatgaaacgcgccggc
gcacggaccatggcgcaggacgaggccagttgcgtggtcttcggcatgccgcgcgaggcc
atcgcgctgggcgcggccgacgaggtcgtgccgctggccgacatcagtgagcggattctg
acgcgtctgggcgaccgcgggcatcgcgtttga

DBGET integrated database retrieval system