KEGG   Bordetella pertussis CS: BPTD_1118Help
Entry
BPTD_1118         CDS       T01846                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpc  Bordetella pertussis CS
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPTD_1118 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPTD_1118 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BPTD_1118 (odhB)
Enzymes [BR:bpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BPTD_1118 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1212367..1213581
Genome map
AA seq 404 aa AA seqDB search
MAITDVLVPQLSESVSEATLLTWKKQAGAAVEADEILIEIETDKVVLEVPAPSSGVLSEI
VMGDGSTVTSGEVIARIDTAAKAAAAPAAAAEAPAAAAAPAAAAPAAASSAASGVASPAA
AKILAEKGVDAASVAGTGRDGRVTKGDALAAGNAPAAKAAAPVAPPTLSLDGRPEQRVPM
SRLRARIAERLLQSQAENAILTTFNEVNMQAVMDLRARYKDKFEKEHGVKLGFMSFFVKA
AVAALKKYPVLNASVDGKDIIYHGYFDIGIAVGTPRGLVVPILRNADQLTIAEIEKTIAD
FGKRAADGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQAAILGIHATKERPVVENGQ
IVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDPQRLLLDL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctattaccgacgttctcgtccctcaactgtccgaatcggtttcggaagccacgctg
ctgacctggaagaagcaggcgggcgccgcggtcgaggccgacgaaatcctgatcgaaatc
gagaccgacaaggtggtgctggaagtgccggccccgtcgtcgggcgtgctgtccgaaatc
gtcatgggtgacggcagcaccgtgacctcgggcgaagtcattgcccgcatcgacacggcc
gccaaggctgctgcggcgcctgccgccgctgccgaagcgcccgccgctgctgctgcgccg
gccgccgccgcgccggccgcggccagcagcgccgccagcggcgtggcctcgccggccgcc
gccaagatcctcgccgagaagggcgtggacgccgccagcgtggccggcaccggccgcgac
ggccgcgtcaccaagggcgacgccctggccgcgggcaacgcgcccgccgccaaggccgcc
gcgccggtggcaccgcccacgctgtcgctggacggtcgccccgagcagcgcgtgccgatg
agccgcctgcgcgcccgcatcgccgagcgcctgctgcaatcgcaagccgagaacgccatc
ctgacgacgttcaacgaagtcaacatgcaggccgtgatggacctgcgcgcccgctacaag
gacaagttcgagaaagagcacggcgtcaagctgggcttcatgtcgttcttcgtcaaggcc
gccgtcgccgcgctgaagaagtacccggtgctcaacgcctcggtcgacggcaaggacatc
atctaccacggctacttcgacatcggcatcgccgtcggcaccccgcgtggcctggtggtg
cccatcctgcgcaacgccgaccagctgaccatcgccgaaatcgagaagaccatcgccgac
ttcggcaagcgcgccgcggacggcaagctgggcatcgaggaaatgaccggcggcacgttc
tcgatctccaacggcggggtgttcggctcgatgctgtccacgcccatcatcaacccgccg
caggcggccatcctgggcatccacgccaccaaggagcgcccggtggtcgagaacggccag
atcgtcatccggccgatcaactacctggccatgtcctatgaccaccgcatcatcgacggc
cgcgaagccgtgctgggcctggtggccatgaaggaagcgctggaagacccgcaacgcctg
ttgctggatctgtaa

DBGET integrated database retrieval system