KEGG   Bordetella pertussis CS: BPTD_1118Help
Entry
BPTD_1118         CDS       T01846                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00020  Citrate cycle (TCA cycle)
bpc00310  Lysine degradation
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01120  Microbial metabolism in diverse environments
bpc01130  Biosynthesis of antibiotics
bpc01200  Carbon metabolism
Module
bpc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPTD_1118 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BPTD_1118 (odhB)
Enzymes [BR:bpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BPTD_1118 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEE66524
Position
1212367..1213581
Genome map
AA seq 404 aa AA seqDB search
MAITDVLVPQLSESVSEATLLTWKKQAGAAVEADEILIEIETDKVVLEVPAPSSGVLSEI
VMGDGSTVTSGEVIARIDTAAKAAAAPAAAAEAPAAAAAPAAAAPAAASSAASGVASPAA
AKILAEKGVDAASVAGTGRDGRVTKGDALAAGNAPAAKAAAPVAPPTLSLDGRPEQRVPM
SRLRARIAERLLQSQAENAILTTFNEVNMQAVMDLRARYKDKFEKEHGVKLGFMSFFVKA
AVAALKKYPVLNASVDGKDIIYHGYFDIGIAVGTPRGLVVPILRNADQLTIAEIEKTIAD
FGKRAADGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQAAILGIHATKERPVVENGQ
IVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDPQRLLLDL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctattaccgacgttctcgtccctcaactgtccgaatcggtttcggaagccacgctg
ctgacctggaagaagcaggcgggcgccgcggtcgaggccgacgaaatcctgatcgaaatc
gagaccgacaaggtggtgctggaagtgccggccccgtcgtcgggcgtgctgtccgaaatc
gtcatgggtgacggcagcaccgtgacctcgggcgaagtcattgcccgcatcgacacggcc
gccaaggctgctgcggcgcctgccgccgctgccgaagcgcccgccgctgctgctgcgccg
gccgccgccgcgccggccgcggccagcagcgccgccagcggcgtggcctcgccggccgcc
gccaagatcctcgccgagaagggcgtggacgccgccagcgtggccggcaccggccgcgac
ggccgcgtcaccaagggcgacgccctggccgcgggcaacgcgcccgccgccaaggccgcc
gcgccggtggcaccgcccacgctgtcgctggacggtcgccccgagcagcgcgtgccgatg
agccgcctgcgcgcccgcatcgccgagcgcctgctgcaatcgcaagccgagaacgccatc
ctgacgacgttcaacgaagtcaacatgcaggccgtgatggacctgcgcgcccgctacaag
gacaagttcgagaaagagcacggcgtcaagctgggcttcatgtcgttcttcgtcaaggcc
gccgtcgccgcgctgaagaagtacccggtgctcaacgcctcggtcgacggcaaggacatc
atctaccacggctacttcgacatcggcatcgccgtcggcaccccgcgtggcctggtggtg
cccatcctgcgcaacgccgaccagctgaccatcgccgaaatcgagaagaccatcgccgac
ttcggcaagcgcgccgcggacggcaagctgggcatcgaggaaatgaccggcggcacgttc
tcgatctccaacggcggggtgttcggctcgatgctgtccacgcccatcatcaacccgccg
caggcggccatcctgggcatccacgccaccaaggagcgcccggtggtcgagaacggccag
atcgtcatccggccgatcaactacctggccatgtcctatgaccaccgcatcatcgacggc
cgcgaagccgtgctgggcctggtggccatgaaggaagcgctggaagacccgcaacgcctg
ttgctggatctgtaa

DBGET integrated database retrieval system