KEGG   Bordetella pertussis CS: BPTD_1291Help
Entry
BPTD_1291         CDS       T01846                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bpc  Bordetella pertussis CS
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bpc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bpc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1394857..1395357)
Genome map
AA seq 166 aa AA seqDB search
MNTMYDFSAPTITGAERALADFRGQVALVVNVASRCGFTPQYSGLEELYRSYRNEGFVVL
GFPCNQFGRQEPGDEAAIAQFCETQYAISFPLFAKIDVNGAHAHPLYRWLKARKPGLLGT
RAIKWNFTKFLVGRDGLPLRRYAPAHTPESLRHDIARACAAPGPTP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatgtacgacttcagcgcccccaccataacgggcgcggaacgcgcgctggcc
gattttcgcggccaggtggcgctggtggtcaatgtcgcctcgcgctgcgggttcacgccc
cagtactcgggcctggaagaactgtaccgctcgtaccgcaacgaaggctttgtcgtcctg
ggatttccgtgcaaccagttcgggcgccaggagccgggcgacgaggccgccatcgcgcag
ttctgcgaaacccagtacgccatcagcttcccgctgttcgccaagatcgacgtcaacggc
gcccacgcccacccgctgtaccgctggctgaaggcacgcaagcccggcctgctgggcacc
cgcgccatcaaatggaatttcaccaaattcctggtcgggcgcgacggcctgccgctgcgg
cgctacgcgcccgcccacacgcccgaatcgctgcgccacgacatcgcgcgcgcctgcgcc
gcgcccggcccgacgccctag

DBGET integrated database retrieval system