KEGG   Bordetella pertussis CS: BPTD_1513Help
Entry
BPTD_1513         CDS       T01846                                 

Definition
putative arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpc  Bordetella pertussis CS
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1628660..1629565
Genome map
AA seq 301 aa AA seqDB search
MGVPARRPAGEAALACVLGIPFDCGTHPFRVGARQGPDAIREQSRLLRPYDLARRAGVDN
PVEFLRLLDLGNVACVPGDPQASYPAIEQAVAQVLQAGAIPITMGGDGAVTLPQLRAVAR
RWPGVAVLHFDSHTDTYPIAGYNTATTFTRAAEEGLIDLSHSFHVGTRGNSFMGGVIEYG
REVGYTVIPYDDFDRDQAGTLARLRGQLGDRPVYLCFDMDIFDPSCAPGVCTPEWGGLSP
KEGLNLLRALSGLNFVAFDVNTVSPPQDVGGATAFLAASVMQEFCALAAAAVQAYPQGRP
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgccggcgcggcgccccgccggagaggccgcgttggcctgtgtgctgggcatt
ccgttcgactgcggcacgcatccgttccgggtgggcgcgcggcaggggccggacgcgata
cgcgagcaatcgcgcctgctgcgcccgtacgacctggcgcgccgcgccggggtggacaac
ccggtggagttcctgcgcctgctggacctgggcaacgtggcctgcgtgccgggcgatccg
caggcttcctatccggccatcgagcaggccgtcgcgcaggtgctgcaagccggcgccatt
cccatcaccatgggcggcgacggcgcggtcacgctgccgcagctgcgcgcggtggcgcgc
cgctggccgggcgtggccgtgctgcatttcgattcgcacaccgacacctatcccatcgcc
ggctacaacaccgccaccaccttcacgcgcgccgccgaggaagggctgatcgatctctcg
cacagtttccacgtgggcacgcgcggcaattcgttcatgggcggcgtcatcgagtacggc
cgcgaagtcggctacacggtgatcccgtacgacgacttcgaccgcgaccaggccggcacg
ctggcgcgcctgcgcggccaattgggcgaccggccggtctacctgtgcttcgacatggat
atcttcgatccctcctgcgcgccgggcgtgtgcacgccggagtggggcggcctctcgccc
aaggagggcctgaacctgctgcgggccctgagcggcctgaacttcgtcgccttcgacgtc
aataccgtatcgccgccgcaggacgtgggcggcgcgacggcgttcctggcggcctccgtg
atgcaagaattctgcgccctggccgccgcggcggtacaggcctatccgcaagggcggccg
gactga

DBGET integrated database retrieval system