KEGG   Bordetella pertussis CS: BPTD_1534Help
Entry
BPTD_1534         CDS       T01846                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bpc  Bordetella pertussis CS
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bpc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1654584..1655192
Genome map
AA seq 202 aa AA seqDB search
MDPQLPEPEPLIALIEALRRLPGVGVRSARRMAYHLLQHDLQGADMLGRALSAAVQHLRH
CARCNSFTEDEVCATCANPKRDPGLLCIVETPADQNMIESSHGYRGLYYVLMGRIAPLEG
VGPRELDFQRVIERACDGVVQEVILATNFTAEGETTAHFLDDALSERGLKVTRLARGVPA
GSELEYVDAGTIAWALMERRST
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggatccccaactacccgaacccgaaccgctgatcgccctgatcgaggcgttgcgccgc
ctgcctggcgtgggcgtgcgctcggcccgccgcatggcctatcacctgctgcagcacgac
ctgcagggggccgacatgctgggccgcgcgctttccgccgccgtgcagcacctgcgccat
tgcgcgcgctgcaacagcttcaccgaagacgaggtctgcgcgacctgtgccaatcccaag
cgcgatcccggcctgctgtgcatcgtcgagacgccggccgaccagaacatgatcgagtcc
agccacggctaccgcgggctgtactacgtgctgatgggacgcatcgcgccgctggaaggg
gtggggccgcgcgagctcgacttccagcgcgtcatcgagcgcgcctgcgacggcgtggtc
caggaggtcatcctggccaccaatttcaccgccgagggcgagacgacggcccacttcctg
gacgatgccctgagcgagcgcggcctgaaagtcacccggctggcgcgcggcgtgccggcc
ggcagcgagctcgagtatgtcgatgccggcaccattgcctgggccttgatggagcgccgt
tcgacctag

DBGET integrated database retrieval system