KEGG   Bordetella pertussis CS: BPTD_1711Help
Entry
BPTD_1711         CDS       T01846                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bpc  Bordetella pertussis CS
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BPTD_1711 (tesA)
Enzymes [BR:bpc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BPTD_1711 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BPTD_1711 (tesA)
Lipid biosynthesis proteins [BR:bpc01004]
 Fatty acid synthase
  Component type
   BPTD_1711 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1841999..1842607)
Genome map
AA seq 202 aa AA seqDB search
MPAQAQTASAPTGSAPHAVLVVGDSLSAEYGLRRGSGWVPMLAQRVSQQSPNYRVVNASI
SGDTTSGGLARLPALLRQHAPAVVVLELGSNDALRGLALDMTERNLRAMAQASRQAGASV
LVVGMQIPPNYGRDYTQRFAQVFPAVAEQEKARLVPFLMEGIATNRAMFQADGIHPNENA
QPALLDNVWPLLEPMLAQPAAD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgccggcccaggctcagaccgcgtccgcgcccacaggttccgcaccgcacgccgtcctg
gtggtcggcgacagcctgtcggccgaatacggcctgcggcgcgggtccggctgggtgccg
atgctggcccagcgggtttcgcaacaatcccccaactaccgcgtcgtcaatgccagcatc
agcggcgatacgaccagcggcgggctggcgcgcctgccggcgctgctgcgccagcacgcg
ccggccgtcgtcgtgctggaactggggtccaacgatgccctgcgcggcctggcgctggac
atgaccgagcgcaatctgcgcgccatggcgcaggcgtcgcgccaggccggcgcatcggtg
ctggtggtcggcatgcagatcccgccgaactacggccgcgactacacccagcgcttcgcg
caggtctttccagccgtggccgaacaggaaaaagcccggctggtgccgttcctcatggaa
ggaatcgccaccaaccgggccatgttccaggccgacggcatccatcccaacgagaacgcc
cagccggcgctgcttgacaatgtctggcccttgctcgagccgatgctggctcagcctgcg
gccgactga

DBGET integrated database retrieval system