KEGG   Bordetella pertussis CS: BPTD_2047Help
Entry
BPTD_2047         CDS       T01846                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpc  Bordetella pertussis CS
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bpc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2225558..2226616
Genome map
AA seq 352 aa AA seqDB search
MSSKKKTKPVLPPGPVMVDVAGTTLTKDEKRRLRNPLVGGVILFARNFTDRRQLCALTRA
IHKARKEPLLIAVDHEGGRVQRFRDDGFTALPPMQELGKLWDRDPLAAMRLATEAGYVLA
AELRACGVDLSFTPVLDLDYGVSKVIGNRAFHHDARVVTMLSRALTQGLALAGMAACGKH
FPGHGFVGADSHHEIPVDPRPLARILKDDAAPYAWLGDLVMPAVMPAHVIYPKVDAQPAG
FSRRWVSEILRERLGYDGVVFSDDLTMEGASVAGDILARAEAALGAGCDMVLVCRPDLAD
ELLDRLQVQHPAASVERIRRLLPRFAAPDWDTLQNDSRYQHARRLQSQIVSG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaagaagaaaaccaagcccgtcctgcctcccggtcccgtcatggtggatgtg
gccggcacgacgctgaccaaggacgagaagcgccgcctgcgcaaccccctggtgggcggg
gtgatcctgttcgcgcgcaatttcaccgatcgccggcaattgtgcgcgctgacgcgggcc
atccacaaggcgcgcaaggagccgctgctgatcgcggtggaccacgagggcggccgcgtg
cagcgctttcgcgacgatggctttaccgcgttgccgcccatgcaggaactgggcaagctg
tgggaccgcgatccgctggcggcgatgcggctggcgaccgaggccggctacgtgctggcc
gccgagctgcgcgcctgcggcgtcgatctcagcttcacgccggtattggacctcgactac
ggcgtgagcaaggtgatcggcaatcgcgccttccaccatgacgcacgcgtggtcaccatg
ctgtcgcgcgcgctgacgcagggcctggcgctggcgggcatggcggcctgcggcaagcat
ttccccggccatgggttcgtgggcgccgattcgcaccacgagatcccggtcgatccgcgg
ccgctcgcgcgcatcctgaaggatgacgcggcgccttacgcctggctgggcgacctggtc
atgccggctgtcatgccggcgcatgtgatctatccgaaggtcgatgcccagcccgcgggt
ttttcgcgccgctgggtcagcgagatcctgcgtgaacggctgggctacgatggcgtggtg
ttctccgacgatctgaccatggagggcgcgtcggtggcgggcgacatcctggcccgcgcc
gaggcggccctgggcgccggctgcgacatggtgctggtatgccgcccggacctggccgac
gagctgctggaccgcctgcaggtccagcatccggccgcctcggtcgagcgcatccgccgg
ctgttgccgcggttcgccgcgccggactgggacactttgcagaatgacagccgctatcag
catgcccgacgacttcaatctcaaatcgtttctggctga

DBGET integrated database retrieval system