KEGG   Bordetella pertussis CS: BPTD_2320Help
Entry
BPTD_2320         CDS       T01846                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00020  Citrate cycle (TCA cycle)
bpc00190  Oxidative phosphorylation
bpc00650  Butanoate metabolism
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01120  Microbial metabolism in diverse environments
bpc01130  Biosynthesis of antibiotics
bpc01200  Carbon metabolism
Module
bpc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPTD_2320 (sdhD)
   00650 Butanoate metabolism
    BPTD_2320 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BPTD_2320 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Bap31 CybS
Motif
Other DBs
NCBI-ProteinID: AEE67610
Position
complement(2526010..2526393)
Genome map
AA seq 127 aa AA seqDB search
MADTKNYGPKRLVVGAHYGVTDFIAQRITAVILAVYTLVLIVGLLIMPAFTYENWKALFT
FHVFALPVGQILASLAFFALAWHAWIGVRDIWMDYVRPVGVRLLLQVLTILWLVGSVVYF
AQILWRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacgaaaaactatggccccaagcgcctggtcgtcggcgcccactacggggtt
accgatttcatcgcccagcgcatcaccgccgtcatcctggccgtgtataccctggtgctg
atcgtcggcctgctgatcatgccggctttcacgtatgaaaactggaaggccctgttcacc
ttccacgtgttcgcccttccggtgggccagatcctggcctcgctcgctttctttgcgctg
gcctggcatgcctggatcggcgtgcgcgacatctggatggactatgtccgcccggtaggc
gtgcgcctgctgctgcaggtgctgaccatcctctggctggtcggttcggtcgtctacttc
gcgcaaatcctctggagaatctaa

DBGET integrated database retrieval system