KEGG   Bordetella pertussis CS: BPTD_2412Help
Entry
BPTD_2412         CDS       T01846                                 

Definition
putative oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bpc  Bordetella pertussis CS
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bpc00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bpc00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2619584..2620366)
Genome map
AA seq 260 aa AA seqDB search
MLKGKVAVVTGSTSGIGLGIASALAQQGADIVLNGFGDAADIEKLRAGLASQYGVQVRYD
GADLSKGEAVRQLVSGAVAELGRIDILVNNAGIQHTALIEDFPADKWDAIIALNLSAVFH
GTAAALPHMKKQGWGRIINIASAHGLVASAAKSAYVAAKHGVVGLTKVTALETAGMGITA
NAICPGWVRTPLVEKQITALAAKDGVDQESAARELLGEKQPSLQFVTPEQLGGTAVFLAS
EAAAQITGTTISVDGGWTAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaggaaaagttgcagtcgtcaccggttccaccagcggcatcggcctggggatc
gccagcgcgctggcgcagcagggcgccgacatcgtgctcaacggattcggcgacgcggcg
gacatcgagaaattgcgggccgggctggccagccagtacggcgtgcaggtgcgctatgac
ggcgccgacctgtccaagggcgaggcggtgcggcaactggtgtccggcgccgtcgccgag
ctgggccgcatcgatatcctggtcaacaacgcgggcatccagcacaccgccttgatcgag
gactttcccgccgacaagtgggacgccatcatcgcgctgaatctctcggcggtattccat
ggcacggccgcggcgctgccccacatgaagaagcagggctgggggcgcatcatcaacatc
gcctcggcccatggcctggtggcctcggccgcgaagtccgcctacgtggccgccaagcac
ggcgtggtcggcctgaccaaggtcaccgcgctggagacggccggcatgggcatcaccgcc
aacgccatctgccccggctgggtgcgcacgccgttggtggaaaagcagatcaccgccctg
gcggccaaggacggcgtcgaccaggaaagcgccgcgcgcgaactgctcggcgagaagcag
ccgtcgctgcagttcgtcacgcccgagcaactgggcggcacggccgtgttcctggcctcg
gaggccgcggcccagatcaccggcaccaccatttccgtcgacggcggctggacagcccgc
tag

DBGET integrated database retrieval system