KEGG   Bordetella pertussis CS: BPTD_2496Help
Entry
BPTD_2496         CDS       T01846                                 

Definition
(GenBank) putative uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00860  Porphyrin and chlorophyll metabolism
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01120  Microbial metabolism in diverse environments
Module
bpc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPTD_2496
Enzymes [BR:bpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BPTD_2496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEE67774
Position
complement(2712175..2712963)
Genome map
AA seq 262 aa AA seqDB search
MSQIAILTRPQGRNGALAQRLHDAGWQTLCLPALRIEPLPPENGVVPLPRDYDLVVFVSG
NAARLYLEQLRERGELPWPAGAVAATVGPASARALLDSGQFGADTTVLHPAETAPTHDSE
ALWALLRARPALPRRALLVRGTQGRDWLADRLVAAGVEVSRHAVYRRRPAPWAQEGRQRL
RDWALAGERPTWLLTSGEGIDALVQGLREEQLLDWWLQGRFVVTHPVLAERLRALAGGGA
DAPMVKNCMPADEAIFATFVAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagattgccatcctgacacggccgcaaggccgcaatggcgcgcttgcgcaacgc
ctgcacgacgccggttggcagaccctttgcctgccggccttgcgcatcgagccgttgccg
cccgaaaacggcgtggtgccgctgccgcgcgactacgacctggtggtgtttgtcagcggc
aacgcggcgcgcctgtacctggagcagctgagggagcggggcgaattgccatggccggca
ggcgcggtcgccgccaccgtgggcccggccagcgcccgcgccctgctggattcgggccag
tttggcgccgatacaacagttttgcaccccgcggaaaccgcgcccacccacgattcggaa
gccttgtgggccttgttgcgggcgcgtccggcattgccgcgccgcgcgctgctggtgcgc
ggcacgcaggggcgcgactggctggccgatcgcctggttgcggctggcgtggaggtcagc
cgccacgccgtctaccgccggcggcccgcgccctgggcgcaggaggggcgccagcgcctg
cgcgactgggccctggcgggcgagcgcccgacctggctgctcaccagcggcgagggcatc
gacgcgctggttcagggcctgcgcgaggagcaattgctggactggtggctgcagggccgt
ttcgtcgtcacgcaccccgtgctggccgagcggctgcgggcgctggccggtggcggcgcc
gatgcgccaatggtaaaaaactgcatgcctgccgatgaggcgatcttcgcgacttttgtt
gcggcttga

DBGET integrated database retrieval system