KEGG   Bordetella pertussis CS: BPTD_3159Help
Entry
BPTD_3159         CDS       T01846                                 

Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpc  Bordetella pertussis CS
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BPTD_3159
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPTD_3159
   00650 Butanoate metabolism
    BPTD_3159
  Lipid metabolism
   00071 Fatty acid degradation
    BPTD_3159
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPTD_3159
   00310 Lysine degradation
    BPTD_3159
   00360 Phenylalanine metabolism
    BPTD_3159
   00380 Tryptophan metabolism
    BPTD_3159
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPTD_3159
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPTD_3159
   00281 Geraniol degradation
    BPTD_3159
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPTD_3159
   00627 Aminobenzoate degradation
    BPTD_3159
   00930 Caprolactam degradation
    BPTD_3159
Enzymes [BR:bpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPTD_3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3450239..3451021
Genome map
AA seq 260 aa AA seqDB search
MSAQTPDAAEVLVDRADGILTITINRPQARNAINLAVARGIAAAVDELDASDDLRIGILT
GAGGSFCAGMDLKGFLRGERPSIEGRGFGGLTARPPRKPLIAAVEGYALAGGFELVLACD
LVVAADNAQFGVPEVKRGLAATAGGLVRLQRQLPYRIALELALTGDMFPARRAHGYGLIN
QLTEPGQALEAARELARRIVANGPLAVAASKRVVVESQDWPADEVWERQAALTDHVFESA
DAREGSAAFAEKRQPVWQGK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcaaacccccgatgccgcggaagtcctcgtcgaccgcgccgacggcattctc
accattaccatcaaccgcccgcaggcccgcaacgcgatcaacctggcggtggcgcgcggc
atcgccgcggcggtggacgagctggacgccagcgacgacctgcgcatcggcatcctgacc
ggcgccggcggctcgttctgcgccggcatggatctcaagggctttctgcgcggcgagcgg
cccagcatcgaggggcgcggctttggcggactgaccgcccggccgccgcgcaagccgctg
atcgcggcggtggagggctatgcgctggccggcggcttcgaactggtgctggcctgcgac
ctggtggtggcggccgacaatgcgcagttcggcgtgcccgaggtcaagcgcgggctggcg
gccacggccggcggcctggtgcgcctgcagcgccagctgccctaccgcatcgcgctggag
ctggcgctgaccggcgacatgttcccggcccggcgcgcccacggctatggcctgatcaac
cagctgaccgaacccggccaggcgctggaggccgcgcgcgaactggcgcggcgcatcgtc
gccaacggaccgctggccgtggccgccagcaagcgggtggtggtcgagtcgcaggactgg
ccggccgacgaggtgtgggagcgccaggcggcgctgaccgaccatgtgttcgagtcggcc
gacgcgcgcgagggctcggcggccttcgcggagaagcgccagcccgtgtggcaggggaag
tag

DBGET integrated database retrieval system