KEGG   Bordetella pertussis CS: BPTD_3229Help
Entry
BPTD_3229         CDS       T01846                                 

Definition
putative thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bpc  Bordetella pertussis CS
Brite
Enzymes [BR:bpc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BPTD_3229
Secretion system [BR:bpc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BPTD_3229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3527834..3528673
Genome map
AA seq 279 aa AA seqDB search
MSGPSFSGAGMNFRITVWCAAAAVWSSGALAQDGAGQAAPGTPDKVYSTTGSAPAKPGDK
VYSTRSAQAPDPQADAVKERFAQRFEGFDVTAVRRTPYGLFEVQIGTDLLYTDEKVTWVM
EGPLIDALTRRDVTRERQEKLSSVPFEELPLDLAVKQVKGDGSRVMAVFEDPNCGYCKQL
HRTLEDMDNITVYTFLYPILSPDSTTKVRDIWCASDPAKVWKDWMVRGQRPPTAECDAPV
DQWLALGRQLMVRGTPAIFFKSGGRVSGALPRDELEARL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgggccgtcgttttcaggagcaggtatgaatttccggatcacagtctggtgcgcc
gccgccgcggtgtggagctcgggcgccctggcgcaggatggtgccggccaggccgccccg
ggcacgccggacaaggtctactcgaccaccgggagcgcgcccgccaagccgggcgacaag
gtgtattccacccgttcggcgcaggcgcccgatccgcaggccgatgccgtcaaggagcgg
ttcgcgcagcgtttcgaggggttcgacgtgacggcggtgcgacgcaccccgtacgggctg
ttcgaggtgcagatcggaacggatttgctgtacaccgatgaaaaggtcacctgggtcatg
gaggggccgctcatcgacgccctgacccggcgcgatgtcacccgcgaacgccaggaaaaa
ctgtccagcgtcccgttcgaggagctgccgctggacctggcggtcaagcaggtcaagggc
gacggttcgcgcgtcatggccgtattcgaggatccgaactgcggctattgcaagcaactg
caccgcacgctggaggacatggacaacatcacggtctacaccttcctgtatccgatcctc
tcgccggactcgacgaccaaggtgcgcgacatctggtgcgcttcggatcctgccaaggtc
tggaaagactggatggtgcgcggccagcgtccgcccaccgccgagtgcgatgcgccggtc
gaccaatggctggcgctgggccgccagctgatggtgcgcggcacgcccgcgattttcttc
aagagcggcggccgcgtcagcggcgcgctgccgcgcgacgaactcgaagcgcgtctgtag

DBGET integrated database retrieval system