KEGG   Bordetella pertussis CS: BPTD_3356Help
Entry
BPTD_3356         CDS       T01846                                 

Definition
putative UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpc  Bordetella pertussis CS
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BPTD_3356
   00052 Galactose metabolism
    BPTD_3356
   00500 Starch and sucrose metabolism
    BPTD_3356
   00520 Amino sugar and nucleotide sugar metabolism
    BPTD_3356
Enzymes [BR:bpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BPTD_3356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3651217..3652125
Genome map
AA seq 302 aa AA seqDB search
MIARGGKKFAASTNFPALPPGVFMQVVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPL
IQYAVEEAVAAGITDLIFVTGRNKRAIEDHFDAAPELETDLEAKGKHELLALVRDILPAH
VNCLYIRQSAPLGLGHAVLTAAPAVGNEPFAVLLADDLIDADTPVLKQLIDVAVARQGSV
LGVQEVPREDTRKYGIVASQPVDARTERVTHIVEKPAPEQAPTTLAVVGRYVLEAAIFDH
LRATTVGAGNEIQLTDGIAALLRERDVYAHRYDGKRYDCGSKAGMFQATVALGRKYHGLI
PE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatagccagaggtggtaaaaagtttgccgcttcgacaaattttcccgcacttccccct
ggagttttcatgcaagttgtccgcaaagccgtctttcccgtggccggtatgggcacccgt
tttctgcccgccaccaaggccatgccgaaggaaatgctgccggtcgtggacaaacccctg
atccaatatgccgtcgaagaggccgtcgccgctgggatcaccgacctcatcttcgtcacg
ggccgcaacaagcgggccatcgaagaccatttcgatgccgcccccgagctggaaaccgac
ctggaagcgaagggcaagcacgaactgctggcgctggtccgcgacatcctccccgcgcac
gtgaactgcctgtacatccgccaatcggccccgctgggcctgggacatgccgtgctgacg
gccgcgccggcggtaggcaacgagcccttcgcggtgctgctggccgatgacctgatcgac
gccgacacgccggtgctcaagcagctgatcgacgtggcggtggcgcgccagggcagcgtg
ctgggcgtacaggaggtgccgcgcgaagacacgcgcaaatacggcatcgtggccagccag
ccagtcgatgcgcgcaccgagcgtgtcacccacatcgtcgagaaacccgcccccgagcaa
gcccccaccaccctggcggtcgtcggccgctatgtgctggaggcagccattttcgaccat
ctgcgtgccaccacggtcggggcgggcaatgaaatccagctgacggacggtatcgccgcg
ctgctgcgcgaacgcgacgtctatgcgcaccgctatgacggcaagcgctatgactgcggc
agcaaggcgggcatgttccaggccaccgtggccctgggccgcaaataccacggcctgatt
ccggaataa

DBGET integrated database retrieval system