KEGG   Bordetella pertussis CS: BPTD_3455Help
Entry
BPTD_3455         CDS       T01846                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bpc  Bordetella pertussis CS
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bpc00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3757034..3757681
Genome map
AA seq 215 aa AA seqDB search
MKLPVDGLIASFDVDAQKSFTPLCPDELPVPDGHAIVPELNAQAAHADLRLGSKDAHSPH
AIWRATADQPMFSPVAGANVDVRWNMHCVPGTRGFELLDGLPAPAAYDFFVWKGVEPDMH
PYGSCYHDLAERQPTGVIEFLRARDVRCVLVGGLALDYCVKVTALQLRRAGLEVVVNLAA
CRGIAAATCEQARRELSQAGVRTVPHAGVLVRAGR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcctgtcgacgggctgatcgcgtcgttcgacgtggatgcacaaaagagtttc
acgccgctttgcccggatgaactgccggtgcccgacgggcacgcgatcgtccctgaactc
aacgcccaggcggcgcacgcggatctgcgactgggatcgaaagatgcgcacagccctcac
gccatctggcgggcgacggccgatcaacccatgttcagcccggtggcgggcgccaacgtc
gacgtgcgctggaacatgcactgcgtgccgggcacgcgcggcttcgagttgctcgacggc
ttgccggcgccggccgcctacgatttcttcgtctggaaaggcgtggagcccgacatgcat
ccgtacgggtcttgttaccacgacctggccgagcggcagccgaccggcgtcatcgagttc
ctgcgcgcgcgcgacgtgcgctgcgtgctggtgggcggcctggcgctggattactgcgtc
aaggtgacggccctgcagctgcgtcgcgccgggctggaggtcgtggtcaatctggcggcg
tgccgcggcattgccgccgcgacgtgcgaacaggccaggcgggagctgagccaggccggg
gtgcgcaccgtgccgcatgccggcgtgctggtgcgcgccggccgctga

DBGET integrated database retrieval system