KEGG   Bordetella pertussis CS: BPTD_3455Help
Entry
BPTD_3455         CDS       T01846                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bpc  Bordetella pertussis CS
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BPTD_3455
Enzymes [BR:bpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BPTD_3455
    3.5.1.-  
     BPTD_3455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3757034..3757681
Genome map
AA seq 215 aa AA seqDB search
MKLPVDGLIASFDVDAQKSFTPLCPDELPVPDGHAIVPELNAQAAHADLRLGSKDAHSPH
AIWRATADQPMFSPVAGANVDVRWNMHCVPGTRGFELLDGLPAPAAYDFFVWKGVEPDMH
PYGSCYHDLAERQPTGVIEFLRARDVRCVLVGGLALDYCVKVTALQLRRAGLEVVVNLAA
CRGIAAATCEQARRELSQAGVRTVPHAGVLVRAGR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcctgtcgacgggctgatcgcgtcgttcgacgtggatgcacaaaagagtttc
acgccgctttgcccggatgaactgccggtgcccgacgggcacgcgatcgtccctgaactc
aacgcccaggcggcgcacgcggatctgcgactgggatcgaaagatgcgcacagccctcac
gccatctggcgggcgacggccgatcaacccatgttcagcccggtggcgggcgccaacgtc
gacgtgcgctggaacatgcactgcgtgccgggcacgcgcggcttcgagttgctcgacggc
ttgccggcgccggccgcctacgatttcttcgtctggaaaggcgtggagcccgacatgcat
ccgtacgggtcttgttaccacgacctggccgagcggcagccgaccggcgtcatcgagttc
ctgcgcgcgcgcgacgtgcgctgcgtgctggtgggcggcctggcgctggattactgcgtc
aaggtgacggccctgcagctgcgtcgcgccgggctggaggtcgtggtcaatctggcggcg
tgccgcggcattgccgccgcgacgtgcgaacaggccaggcgggagctgagccaggccggg
gtgcgcaccgtgccgcatgccggcgtgctggtgcgcgccggccgctga

DBGET integrated database retrieval system