KEGG   Bordetella pertussis CS: BPTD_3536Help
Entry
BPTD_3536         CDS       T01846                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpc  Bordetella pertussis CS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPTD_3536 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPTD_3536 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPTD_3536 (trpB)
Enzymes [BR:bpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPTD_3536 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3840799..3841998
Genome map
AA seq 399 aa AA seqDB search
MKPYDLPDARGHFGPYGGVFVAETLMHALDELRAAYDQCRVDPSFIDEFNYELKHFVGRP
SPVYHASRWSQRLGGAQIWFKREDLNHTGAHKVNNCIGQALLARRMGKPRVIAETGAGQH
GVATATVAARYGMECVVFMGSEDVRRQASNVYRMKLLGATVVPVDSGSCTLKDALNEAMR
DWVTNIENTFYIIGTVAGPDPYPRMVRDFQTVIGQECLTQMPEVIGRQPDYVVAAVGGGS
NAMGIFHPYIPYENVRLIGVEAAGEGMETGRHAASLAAGQIGVLHGNRTYVMQNADGQVQ
ETHSVSAGLDYPGVGPEHAWLKDSGRAEYAGITDDEALAAFHDCCRIEGIMPALESAHAI
AQAVKMTPALSKDKVILVNLSGRGDKDMHTVAERAGLQL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccttacgaccttccggatgcccggggccatttcggcccctatggcggtgtgttt
gtggcggaaacgctgatgcacgccctagacgagctgcgcgcggcctatgaccagtgccgc
gtcgatcccagcttcatcgacgagttcaattacgagctcaagcatttcgtcggccggccc
agcccggtctaccacgccagccgctggtcgcagcgcctgggcggcgcgcagatctggttc
aagcgcgaagacctcaaccatacgggcgcgcacaaggtcaacaattgcatcggccaggcg
ctgctggcgcggcgcatgggcaagccgcgcgtcatcgccgagaccggcgccggccagcac
ggcgtggccacggccacggtggcggcccgctatggcatggaatgcgtggtgttcatgggc
agcgaggacgtgcgccgccaggcctccaacgtctatcgcatgaagctgctgggcgccacg
gtggtgccggtggactcgggctcgtgcaccctgaaggacgcgctgaacgaagccatgcgc
gactgggtcaccaacatcgagaatacgttctacatcatcggcacggtggccgggcccgac
ccctacccgcgcatggtgcgcgacttccagaccgtcatcggccaggagtgcctgacccag
atgcccgaagtcatcggccgccagcccgactatgtggtcgcggcggtgggcggcggctcc
aacgccatgggcattttccatccctacatcccgtacgagaacgtgcgcctgatcggcgtc
gaggcggcgggcgagggcatggaaaccggccgccatgcggcgtcgctggcggcgggccag
atcggcgtgctgcacggcaaccgcacctatgtcatgcagaatgccgacggccaggtgcag
gaaacccattcggtgtcggccgggctggattatcccggcgtggggccggagcatgcatgg
ctcaaggacagcggccgcgccgagtacgcgggcatcaccgacgacgaggcgctggcggcg
ttccacgattgctgccgcatcgagggcatcatgccggcgctggagtccgcgcacgccatt
gcgcaggccgtgaaaatgacgcctgcgctttccaaggacaaggtcatcctggtcaatctg
tccggccggggcgacaaagacatgcacaccgtggccgagcgcgcgggccttcagctctga

DBGET integrated database retrieval system