KEGG   Bordetella pertussis CS: BPTD_3537Help
Entry
BPTD_3537         CDS       T01846                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00260  Glycine, serine and threonine metabolism
bpc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01130  Biosynthesis of antibiotics
bpc01230  Biosynthesis of amino acids
Module
bpc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPTD_3537 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPTD_3537 (trpA)
Enzymes [BR:bpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPTD_3537 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Peripla_BP_6 PA
Motif
Other DBs
NCBI-ProteinID: AEE68717
Position
3842002..3842859
Genome map
AA seq 285 aa AA seqDB search
MTTTDRIAAAFARVSEAGRAAALIPYIAAGDPSPQATVPLMHALVRAGADLVELGVPFSD
PMADGPVVQRAAERAIAQGVGLRRVLELVADFRRDDSVTPVVLMGYANPIERMGQRAFAQ
AAQAAGVDGVLVVDYPPEEVDEFAVMLAEAGVAPIFLLAPTSTEARIEAIGRVARGYVYY
VSLKGVTGAGSLDTDDVARKLALIRRHVHIPVGVGFGIRDAASAQRIAAHADAVVIGSKL
IETMEQAGAQAGADQKNEAAIAAAQQWLHTIRLALDDVKRENAPA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgactaccactgaccgaattgccgccgcgtttgcgcgggtttccgaggccggccgcgcg
gcggccctgatcccctacatcgccgccggcgacccgtcgccgcaggcgacggtaccgctg
atgcacgcgctggtgcgcgccggcgccgacctggtcgagctgggcgtgccgttctccgac
cccatggccgacggtccggtggtgcaacgcgccgccgagcgcgccatcgcccagggcgtc
gggctgcgccgcgtgctggagctggtggccgacttccgccgggacgacagcgtcacgccg
gtagtgctgatgggctatgccaatccgatcgaacgcatgggccagcgggcgtttgcgcag
gccgcgcaggcggccggcgtcgacggcgtgctggtggtcgactatccgcccgaagaggtc
gacgagttcgcggtcatgctggccgaagccggcgtggcgccgatcttcctgctggcgccc
acctccaccgaggcccgcatcgaggcgatcggccgcgtggcgcgcggctacgtctattat
gtgtcgctcaagggcgtcacgggcgccggcagcctggatacggacgacgtcgcgcgcaag
ctggcgctgatccgccgccacgtgcacattccggtgggcgtgggcttcggcatccgcgac
gcggccagcgcgcagcgcatcgccgcgcacgccgacgccgtggtcatcggcagcaagctg
atcgagaccatggagcaggccggcgcccaggccggcgcggaccagaaaaacgaggccgcc
atcgcggcggcgcagcaatggctgcacaccatccggctggcgctggatgacgtcaaacga
gaaaacgcgccggcctga

DBGET integrated database retrieval system