KEGG   Bordetella pertussis CS: BPTD_3546Help
Entry
BPTD_3546         CDS       T01846                                 

Definition
putative protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bpc  Bordetella pertussis CS
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3854430..3855110
Genome map
AA seq 226 aa AA seqDB search
MNASTLPDVEQARFNMVEQQIRPWDVLDPKVLDALFAVRRELFVPPALRALAFSDLEIPL
EINAVNTRQNMLAPKIEARLAQELLLQPTDCVLEIGTGSGYQAALLAYLAQQVTTVEIDS
RLATFAQQNLQVNNVADVKVETGDGRNGWGSTEYDAILVTGSVPVVPDALKYQLRVGGRL
VVIVGQAPIMTAYRITRTTAASFETVSLFETVIKPLRGTTVSQFKF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttcgaccctgcccgacgtagaacaagcccgattcaacatggtggaacagcaa
atccgcccctgggacgtgctggatcccaaggtgctggacgccctgttcgccgtacgccgg
gaattgttcgtgccgccggcgctacgcgccctggccttctccgacctcgaaatcccgctt
gaaatcaacgcggtcaacacgcgccagaacatgctggcccccaagatcgaggcgcgcctg
gcccaggaactgctgctgcagccgaccgactgtgtgctggagatcggcaccggctcgggc
taccaggccgccctgctggcctacctggcgcaacaggtgaccacggtcgaaatcgacagc
cgcctggccaccttcgcccagcagaacctgcaggtgaacaatgtggccgacgtcaaggtc
gaaacgggcgacggccgcaatggctggggctcgaccgaatacgacgcgatcctggtcacc
ggttcggtgccggtggtgcccgacgcgctgaaataccagttgcgcgtgggcggccggctg
gtcgtcatcgtcggacaggcgcccatcatgaccgcctaccgcatcacgcgcaccacggcc
gccagcttcgagaccgtctcgctgttcgagaccgtcatcaagccgctgcgcggcaccacc
gtatcccagttcaaattctga

DBGET integrated database retrieval system