KEGG   Bordetella pertussis CS: BPTD_3625Help
Entry
BPTD_3625         CDS       T01846                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bpc  Bordetella pertussis CS
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPTD_3625 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BPTD_3625 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BPTD_3625 (glcB)
Enzymes [BR:bpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BPTD_3625 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3926478..3928655)
Genome map
AA seq 725 aa AA seqDB search
MTERIPHHGLQVAASLHRFIEDEALSGSGLAPDEFWAGFAALVRDLAPRNRELLAERDRL
QGEIDAWHRAHPGPVRDSAGYQALLERIGYLQPQPAQVTASTRDVDSEIASQAGPQLVVP
VSNARYALNAANARWGSLYDALYGTDAIPPVAGDDGKGYNPARGEAVIARARAFLDEAAP
LAQGSHADATAYAIEGGKLVVTLGAGQRTGLRNPAQLAGYQGDASQPAAVLLANNGLHFE
IQIDRQHQIGATDAAGVKDVLLEAALTTIMDCEDSVAAVDADDKVLIYRNWLGLMKGDLS
ESVTKGGKTFTRRLNADRQYHKPDGGTLTLHGRSLMFVRNVGHLMTNPAILDEQGSEVPE
GILDAVITSLAALPDRANRLNSRTGSIYIVKPKMHGPAEAAFANELFDRVEDLLKLPRHT
IKMGIMDEERRTSVNLKACIAAAAARVAFINTGFLDRTGDEMHTGMEAGPMLRKGDMKSS
AWITAYERNNVLVGLDCGLRGRAQIGKGMWAMPDMMAAMLEQKIGHPKAGANTAWVPSPT
AATLHAMHYHQVDVAAVQQALEQTRYDSVRDELLAGLLTVPVGDPAAWSADDIQRELDNN
AQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLRHGIVDRAQVNAT
FERMAKVVDQQNAGDPNYLPMAGHFDTSFAYRAACALVFEGLTQPNGYTEPLLHEYRQAF
KAARR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcatcccgcatcatggcctgcaagtggcggcctccctgcaccgtttcatc
gaagacgaggcgctgtccggcagcggcctggcgcccgacgagttctgggctggcttcgct
gccctggtgcgcgacctcgcgccgcgcaaccgcgaactgctggccgagcgcgaccgcctg
cagggcgaaatcgacgcctggcaccgcgcccatcccggccccgtgcgcgacagcgccggg
tatcaggcgctgctcgaacgcatcggctacctgcagccccagccggcacaggtaaccgcc
agtacccgcgacgtggacagcgagatcgccagccaggccggcccgcagctggtggttccc
gtctccaacgcgcgctatgcgctgaacgcggccaacgcccgctggggcagcctgtacgac
gcgctctatggcaccgacgcgatcccgccggtggccggcgatgacggcaagggctacaac
ccggcgcgcggcgaagccgtgatcgcccgcgcgcgcgccttcctggacgaggcggcgccg
ctggcccagggttcgcacgccgacgccaccgcctacgccatcgagggtggcaagctggtg
gtcacgctgggcgccggccagcgcacgggcctgcgcaaccccgcgcaactggccggctat
cagggcgacgcctcgcaaccggccgccgtgctgctggccaacaacggcctgcacttcgaa
atccagatcgaccgccagcaccagatcggcgccaccgatgccgccggcgtcaaggacgtg
ctgctcgaggccgccctgaccaccatcatggattgcgaagactccgtggcggccgtcgat
gccgacgacaaggtactgatctaccgcaactggctcgggctcatgaagggcgacctgagc
gaatcggtcaccaagggcggcaagaccttcacccgccgcctgaacgccgaccgccagtac
cacaagcccgacggcggcaccctgacgctgcacggccgctcgttgatgttcgtgcgcaac
gtcggccacctgatgaccaacccggccatcctcgacgagcagggcagtgaagtgccggaa
ggcatcctggatgcggtgatcaccagcctggccgctctgcccgaccgcgccaaccggctc
aactcgcgcaccggctcgatctacatcgtcaagcccaagatgcacgggccggccgaggcc
gccttcgccaacgagttgttcgaccgcgtcgaggacctgctcaagctgccgcgccacacc
atcaagatgggcatcatggacgaagagcggcgcaccagcgtcaacctgaaggcctgcatc
gcggccgcggcggcgcgcgtggctttcatcaacaccggattcctggaccgcaccggcgac
gaaatgcataccggcatggaggccggcccgatgctgcgcaagggcgatatgaaatccagc
gcctggatcaccgcctacgagcgcaacaacgtgctggtcgggctggactgcggcctgcgc
gggcgcgcccagatcggcaagggcatgtgggccatgcccgacatgatggcggccatgctc
gaacagaagatcggccaccccaaggcgggcgccaacacggcctgggtgccctcgcccacg
gccgcgaccctgcacgccatgcactatcaccaggtcgacgtcgcggccgtgcagcaggcg
ctggagcaaacccgctacgacagcgtgcgcgacgaactgctggccggcctgctgaccgtt
ccggtaggcgatccggccgcctggtcggccgatgacatccagcgcgagctcgacaacaac
gcccagggcatcctgggctacgtggtgcgctggatcgaccagggcgtgggatgctcgaag
gtgcccgacatcaacaacgtcggcctgatggaagaccgcgccaccctgcgcatctccagc
cagcacatcgccaactggctgcgccacggcatcgtcgaccgcgcacaggtcaacgccacg
ttcgaacgcatggccaaggtcgtcgaccagcaaaacgccggcgatcccaactacctgccc
atggccggccacttcgacacctcgttcgcctaccgcgcggcgtgcgcgttggtattcgag
ggcctgacccagcccaacggctacaccgagcccctgctgcacgagtaccggcaagccttc
aaggcggcccggcgctga

DBGET integrated database retrieval system