KEGG   Bordetella pertussis CS: BPTD_3768Help
Entry
BPTD_3768         CDS       T01846                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bpc  Bordetella pertussis CS
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BPTD_3768 (glpK)
Enzymes [BR:bpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BPTD_3768 (glpK)
Exosome [BR:bpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPTD_3768 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4070340..4071866
Genome map
AA seq 508 aa AA seqDB search
MTANEFILALDQGTTSSRAIVFDRAGTVRGMGQREFRQHYPRPGWVEHDAGEIWQSQLEV
AREALRNAGASAADLAALGITNQRETTLIWERATGRPLARAIVWQDRRTAAMCEKLLHDG
HGRMLQERTGLVVDAYFSGTKLAWLLDHVPGARKMAERGELAFGTMDTWLVWQLTGGAVH
STDPSNASRTMLFDLHAQDWSDDILALLNIPRGILPRIAPSSARIGETLPEWLGGSIPIA
GVAGDQQAATFGQACFTPGMAKNTYGTGCFMLMNVGDAPVASRHNLLSTVGWSLPAGNAT
HATYMVEGGVFMAGAAVQWLRDGLGIIQRSADIEALAASVADTDDVFMVPAFAGLGAPHW
DPYARGTLVGMTRGTTRAHIARATLESIALQSAELLSCMNADSGIPLSELRVDGSAARND
LLMQMQADLLGVPVVRPRVPESTALGAAGLAGLAVGFWSSLDEFGAQWQAERTFEPAWPA
DVREARMQRWRQAVELSKGWSRPAAGHA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcaaatgaattcatcctggcgctggaccagggcacgaccagctcccgcgccatc
gtgttcgaccgcgccggcacagtgcgcggcatggggcagcgcgaattccgccagcactac
ccgcggccgggctgggtcgagcacgatgccggcgaaatctggcaaagccagctcgaggtc
gcgcgcgaggcgctgcgcaacgccggcgccagcgccgccgacctcgccgcgctgggcatc
accaaccagcgcgaaaccaccctgatctgggagcgcgccaccggccgcccgctggcccgc
gccatcgtctggcaggaccgccgcaccgcggcgatgtgcgaaaaactgctgcacgacggc
cacggccggatgctgcaggagcgcaccggcctggtcgtcgacgcgtacttttccggcacc
aagctggcctggctgctcgatcacgtgccgggcgcgcgcaagatggccgagcgcggcgag
ctggccttcggcacgatggacacctggctggtctggcagctgaccggcggcgccgtgcac
agcaccgacccgagcaacgcctcgcgcaccatgctgttcgacctgcacgcccaggactgg
tcggacgatatcctggccctcttgaacattccgcgcggcatattgccgcgcatcgccccc
agcagcgcgcgcatcggcgaaaccctgcccgagtggctgggcggctcgatacccatcgcc
ggcgtggccggcgaccagcaggccgccacgttcgggcaggcctgcttcacgccgggcatg
gccaagaacacctacggcaccggttgcttcatgctgatgaacgtgggcgacgcgccggtg
gcctcgcgccacaacctgctgtccaccgtgggctggagcctgccggcgggcaacgccacg
cacgccacctacatggtggaaggcggcgtgttcatggccggcgcagcggtgcaatggctg
cgcgacggcctgggcatcatccagcgctcggccgacatcgaggccctggcggccagcgtg
gccgacacggacgacgtattcatggtgccggccttcgccggcctgggcgcgccgcactgg
gatccctacgcgcgcggcacgctggtgggcatgacgcgcggcaccacgcgcgcccacatc
gcgcgcgccacgctcgaatcgatcgcgctgcaaagcgccgaactgctgtcgtgcatgaat
gccgacagcggcatcccgctgtccgagctgcgcgtcgacggcagcgcggcgcgcaacgac
ctgctgatgcagatgcaggccgacctgctgggcgtgccggtggtgcgcccgcgcgtgccc
gagtcgaccgcgctgggcgcggccgggctggcgggcctggcggtcgggttctggtcgagc
ctggacgagttcggcgcgcagtggcaggccgaacgcactttcgagccggcctggccggcc
gatgtgcgcgaagcccgcatgcaacgctggcgccaggcggtggagctatcgaagggctgg
tcgcgccctgccgccggccacgcgtga

DBGET integrated database retrieval system