KEGG   Burkholderia pseudomallei 668: BURPS668_0385Help
Entry
BURPS668_0385     CDS       T00481                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BURPS668_0385
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BURPS668_0385
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BURPS668_0385
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BURPS668_0385
Exosome [BR:bpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BURPS668_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:354796..356199
Genome map
AA seq 467 aa AA seqDB search
MSTIKRIAAAAFAAAALSGGFGHAAHAAGQAKNVIFFLGDGMGPATVTASRLYKVGEAGQ
LTMEKLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMSPDTRAIAPGSDANGN
KTVNRCGVGNGTPATTLLELAKARGKAVGAITTTELTHATPAATYSHICHRDAQYDIAAQ
AVPGGAGYNAALGDGVDVLMGGGRNHWTPYDPLANRRGRADGRNLLAELQAKGYAVVATK
DQLAQAGAGKLIGLFSTTSHLEYELDRVAGKGEGATQPSLAEMTAKAIDVLRKNPNGYFL
MVEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLSDTLIVVTADHDHTMTINGYS
KRGNPVLDISRNYRDGQPNKDADGNPYTTLVFGNGANRPNVRVPVDSSTATNDAYLQEVG
VRMGSAGSETHGGGDVMLFADGAGAKAFKGTLDNTKVFGLVKAAFGF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactatcaagcgcatcgcggcggcggcgttcgccgcggcggccctctcgggcggt
ttcggccacgcggcgcacgccgcgggccaggcgaagaacgtgatcttcttcctcggcgac
gggatggggccggccaccgtgacggcgagccgcctctacaaggtcggcgaagccggccaa
ctgacgatggaaaagctgccgcgcaccgcgcgcatcaagaccttctcgaacgacgcgcag
acgacggacagcgcgccgtcgatggccgcgtacatgaccggcgtgaagatgaacaacgag
gtgctgtcgatgtcgccggacacgcgcgcgatcgcccccggcagcgacgcgaacggcaac
aagacggtgaaccgctgcggcgtgggcaacggcacgccggcgacgacgctgctcgagctc
gcgaaggcgcgcggcaaggcggtcggcgcgatcacgacgaccgagctcacgcacgcgacg
cccgcggcgacttactcgcacatctgccatcgcgacgcgcagtacgacattgccgcgcag
gccgtgccgggcggcgcgggctacaacgcggcgctcggcgacggcgtcgatgtgctgatg
ggcggcggccgcaatcactggacgccgtacgatccgctcgccaacaggcgcggccgcgcg
gacgggcgcaacctgctcgccgagctgcaggcgaagggctacgcggtggtcgcgacgaag
gatcagctcgcgcaggcgggcgcgggcaagctgatcggccttttcagcacgacgagccat
ctcgaatacgagctcgaccgcgtcgcgggcaagggcgagggcgcgacgcagccgagcctc
gcggagatgaccgcgaaggcgatcgacgtgttgcggaagaatccgaacggctatttcctg
atggtcgaaggcgggcgcatcgaccacgcgctgcacggcacgaacgcgaagcgcgcgctc
gaagacacggtggcgttcgacgaggcgatccgcaccgcgctcgcgaaggtcgatctgtcg
gatacgctgatcgtcgtgacggccgatcacgatcacacgatgacgatcaacggctattcg
aagcgcggcaatccggtgctcgacatcagccgcaactatcgcgacggccagccgaacaag
gacgcggacggcaacccgtacacgacgctcgtgttcggcaatggcgcgaaccggccgaac
gtgcgcgtgccggtggattcgtcgacggcgacgaacgacgcgtatctgcaggaagtcggc
gtgcgcatgggcagcgcgggttccgagacgcacggcggcggcgacgtgatgctgttcgcc
gacggcgccggcgcgaaggcgttcaagggcacgctcgacaacacgaaggtgttcggcctc
gtgaaggccgcgttcgggttctga

DBGET integrated database retrieval system