KEGG   Burkholderia pseudomallei 668: BURPS668_0929Help
Entry
BURPS668_0929     CDS       T00481                                 

Gene name
xseA
Definition
exodeoxyribonuclease VII large subunit (EC:3.1.11.6)
Orthology
K03601  
exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    BURPS668_0929 (xseA)
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     BURPS668_0929 (xseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:906640..908022
Genome map
AA seq 460 aa AA seqDB search
MHSESPFAGSGGAPAGDGVIPVSALNRAIGTMLERTFPLLWVAGEVSNFTRAASGHWYFS
IKDQQAQMRCVMFRGRAQHAEFTPREGDRIEVRALVTMYEPRGEVQLSVEAIRRTGQGRL
YEAFLRLKAQLEAEGLFAPERKRAPPTHPRAIGIVTSLQAAALRDVLTTLARRAPHVPVI
VYPAPVQGAGAAEKLAAMVATANARREVDVLIVCRGGGSIEDLWSFNDEALARAIAASDV
PVVCGVGHETDFTIADFAADVRAPTPTGAAELVSPQRALLLRELGERQGALARGLRRGLD
ARAQQLDWLARRLISPAERLQRQAMHVGQLAARLAAAGARPVRDARARFSLVQLRWQRAR
PDFAQARQVLAAFAQRLDATLQRRLERDTARVAACAARLEVLSPQRTLERGYAALIDAQT
GRAVRAPASLKPQRRLTVHLAEGSADVSLADVQPRLSDTF
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcattccgaatctccctttgccggctccggcggcgcgcccgcgggcgacggcgtcatt
cccgtgtccgcgctcaaccgcgcgatcggcacgatgctcgagcgcacgttcccgctgctg
tgggtggcgggcgaagtgtcgaacttcacgcgcgcggcgagcggccactggtatttctcg
atcaaggatcagcaggcgcagatgcgctgcgtgatgttccgcggccgcgcgcagcacgcg
gagttcacgccgcgcgaaggcgacaggatcgaggtgcgcgcgctcgtcacgatgtacgag
ccgcgcggcgaagtgcaactgagcgtcgaggcgatccggcgcaccgggcaggggcggctc
tacgaagcgttcctgcggctgaaggcgcagctcgaagccgaagggctcttcgcgcccgag
cgcaagcgggcgccgccgacgcatccgcgcgcgatcggcatcgtcacgtcgctgcaggcg
gccgcgctgcgcgacgtgctgacgacgctcgcgcgccgcgcgccgcacgtgccggtgatc
gtctatccggcgcccgtgcagggcgcgggcgcggcggagaagctcgccgcgatggtcgcg
acggcgaacgcgcggcgcgaggtcgacgtgctgatcgtctgccgcggcggcggctcgatc
gaggacttgtggtcgttcaatgacgaggcgctcgcgcgcgcgatcgcggcgagcgacgtg
ccggtcgtctgcggcgtcggccacgagaccgatttcacgatcgccgatttcgcggccgac
gtgcgcgcgccgacgccgaccggcgcggcggagctcgtgagcccgcagcgcgcgctgctg
ctgcgcgagctcggcgagcggcagggcgcgctcgcgcgcggcctgcggcgtgggctcgac
gcgcgcgcgcagcagctcgactggctcgcgcgccggctgatcagcccggccgagcgcctg
cagcgccaggcgatgcacgtggggcagctcgccgcgcggcttgccgcggcgggcgcgcgg
cccgtgcgcgacgcgcgcgcgcgtttttcgctcgtgcaattgcgctggcagcgcgcgcgg
cccgacttcgcgcaggcacggcaggtgctcgccgcgttcgcgcaacggctcgatgcgacg
ctgcagcggcgcctcgaacgcgataccgcacgcgtggccgcgtgcgcggcgcggctcgag
gtgctgagcccgcaacgcacgctggagcgcggctacgcggcgctcatcgacgcgcagacg
ggccgcgcggtgcgcgcgcccgcatcgctcaagccgcagcgccggctgaccgtgcacctt
gccgagggctcggccgacgtatcgcttgccgacgtgcaaccgcgtctttcggatacattc
tga

DBGET integrated database retrieval system