KEGG   Burkholderia pseudomallei 668: BURPS668_0929Help
Entry
BURPS668_0929     CDS       T00481                                 

Gene name
xseA
Definition
exodeoxyribonuclease VII large subunit (EC:3.1.11.6)
Orthology
K03601  
exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Mismatch repair
Class
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bpd03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:906640..908022
Genome map
AA seq 460 aa AA seqDB search
MHSESPFAGSGGAPAGDGVIPVSALNRAIGTMLERTFPLLWVAGEVSNFTRAASGHWYFS
IKDQQAQMRCVMFRGRAQHAEFTPREGDRIEVRALVTMYEPRGEVQLSVEAIRRTGQGRL
YEAFLRLKAQLEAEGLFAPERKRAPPTHPRAIGIVTSLQAAALRDVLTTLARRAPHVPVI
VYPAPVQGAGAAEKLAAMVATANARREVDVLIVCRGGGSIEDLWSFNDEALARAIAASDV
PVVCGVGHETDFTIADFAADVRAPTPTGAAELVSPQRALLLRELGERQGALARGLRRGLD
ARAQQLDWLARRLISPAERLQRQAMHVGQLAARLAAAGARPVRDARARFSLVQLRWQRAR
PDFAQARQVLAAFAQRLDATLQRRLERDTARVAACAARLEVLSPQRTLERGYAALIDAQT
GRAVRAPASLKPQRRLTVHLAEGSADVSLADVQPRLSDTF
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcattccgaatctccctttgccggctccggcggcgcgcccgcgggcgacggcgtcatt
cccgtgtccgcgctcaaccgcgcgatcggcacgatgctcgagcgcacgttcccgctgctg
tgggtggcgggcgaagtgtcgaacttcacgcgcgcggcgagcggccactggtatttctcg
atcaaggatcagcaggcgcagatgcgctgcgtgatgttccgcggccgcgcgcagcacgcg
gagttcacgccgcgcgaaggcgacaggatcgaggtgcgcgcgctcgtcacgatgtacgag
ccgcgcggcgaagtgcaactgagcgtcgaggcgatccggcgcaccgggcaggggcggctc
tacgaagcgttcctgcggctgaaggcgcagctcgaagccgaagggctcttcgcgcccgag
cgcaagcgggcgccgccgacgcatccgcgcgcgatcggcatcgtcacgtcgctgcaggcg
gccgcgctgcgcgacgtgctgacgacgctcgcgcgccgcgcgccgcacgtgccggtgatc
gtctatccggcgcccgtgcagggcgcgggcgcggcggagaagctcgccgcgatggtcgcg
acggcgaacgcgcggcgcgaggtcgacgtgctgatcgtctgccgcggcggcggctcgatc
gaggacttgtggtcgttcaatgacgaggcgctcgcgcgcgcgatcgcggcgagcgacgtg
ccggtcgtctgcggcgtcggccacgagaccgatttcacgatcgccgatttcgcggccgac
gtgcgcgcgccgacgccgaccggcgcggcggagctcgtgagcccgcagcgcgcgctgctg
ctgcgcgagctcggcgagcggcagggcgcgctcgcgcgcggcctgcggcgtgggctcgac
gcgcgcgcgcagcagctcgactggctcgcgcgccggctgatcagcccggccgagcgcctg
cagcgccaggcgatgcacgtggggcagctcgccgcgcggcttgccgcggcgggcgcgcgg
cccgtgcgcgacgcgcgcgcgcgtttttcgctcgtgcaattgcgctggcagcgcgcgcgg
cccgacttcgcgcaggcacggcaggtgctcgccgcgttcgcgcaacggctcgatgcgacg
ctgcagcggcgcctcgaacgcgataccgcacgcgtggccgcgtgcgcggcgcggctcgag
gtgctgagcccgcaacgcacgctggagcgcggctacgcggcgctcatcgacgcgcagacg
ggccgcgcggtgcgcgcgcccgcatcgctcaagccgcagcgccggctgaccgtgcacctt
gccgagggctcggccgacgtatcgcttgccgacgtgcaaccgcgtctttcggatacattc
tga

DBGET integrated database retrieval system