KEGG   Burkholderia pseudomallei 668: BURPS668_0972Help
Entry
BURPS668_0972     CDS       T00481                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bpd01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bpd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:952095..953288
Genome map
AA seq 397 aa AA seqDB search
MNSLLDFLSNGLLRFSWWQIVLFTLAVTHVTIVGVTVYLHRCQAHRALDLHPIMSHFFRV
WLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVLLEGAELYRAEAKNEETMR
KYGHGTPNDWLERNVYSKYPILGVSLMMVIDVALFGLVGLTVWAVQMVWIPFWAAGVVNG
LGHFWGYRNFNAADASTNLFPWGIVIGGEELHNNHHTFATSAKLSNKWYEFDIGWMYIRI
MSAFGLAKVKKIAPTPRLAARKTVLDQETLQAVLSNRYEVMARYAKTLKRAYRQELAHLK
ELGAREKYQLMRGARKWFHKDEAGLDEPQKRMLPEIFANSQKLHTFFQLRAELTAIWERS
NASREQLLTQLQDWCHRAEQSGIKALQEFATRLRRYA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgaattccctgctcgatttcctttccaacgggcttctgcgtttctcgtggtggcagatc
gtgctgttcacgctcgccgtcacgcacgtgacgatcgtcggcgtgacggtctatctgcat
cgctgccaggcacaccgcgcgctcgatctgcatccgatcatgagccacttcttccgcgtc
tggctgtggatgacgacgggcatgctgacgggccagtgggcggcgatccaccgcaagcac
catgcgaagtgcgagaccgaggaggatccgcacagcccgcagacgcgcggcatctggaag
gtgctgctcgaaggcgccgagctgtatcgcgcggaggcgaagaacgaggagacgatgcgc
aagtacggccacggcacgccgaacgactggctcgagcgcaacgtctactcgaaatacccg
attctcggcgtgagcctgatgatggtgatcgacgtcgcgctgttcggcctcgtcggcctc
accgtctgggcagtccagatggtgtggatcccgttctgggcggcgggcgtcgtcaacggt
ctcggccacttctggggctaccgcaacttcaacgcggccgacgcgagcacgaacctgttc
ccgtggggcatcgtgatcggcggcgaggagctgcacaacaatcatcatacgtttgcgacg
tcggcgaagctgtcgaacaagtggtacgagttcgacatcggctggatgtacatccgcatc
atgtcggcgttcgggctcgcgaaggtaaagaagatcgcgccgacgccgcggctcgccgcg
cgcaagacggtgctcgaccaggaaacgctgcaggccgtgctgtcgaaccgttacgaggtg
atggcgcgctatgcgaagacgctcaagcgcgcgtacaggcaggagctcgcgcacctgaag
gaactgggcgcgcgcgagaagtatcagctgatgcgcggcgcgcgcaaatggttccacaag
gacgaggcgggcctcgacgagccgcagaagcggatgctgccggagatcttcgcgaacagc
cagaagctgcacacgttcttccaactgcgcgccgagctcacggcgatctgggagcgctcg
aacgcctcgcgcgaacagttgctcacgcagttgcaggactggtgccatcgcgccgagcaa
agcggcatcaaggcgttgcaggagttcgcgacgcgcctgcgccgctacgcgtga

DBGET integrated database retrieval system