KEGG   Burkholderia pseudomallei 668: BURPS668_1016Help
Entry
BURPS668_1016     CDS       T00481                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bpd00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bpd00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bpd03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bpd03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bpd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:991530..991946
Genome map
AA seq 138 aa AA seqDB search
MTRIDFHTNVGDSLAYACRLLRKAYQAGQPVVVCAEPARLRALDERLWTFSPLDFIPHCA
IDNAHAASTPIVLTADLERAPHHGILLNLGAQVPAQFARFERLLEVVGNAPDELAAGRDR
YRFYRDRGYALNNHKQGG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgatttccatacgaatgtcggcgattcgctcgcgtacgcgtgccggctg
ctgcgcaaggcgtatcaggcggggcagcccgtcgtcgtgtgcgcggagcccgcgcggctg
cgcgcgctcgacgagcgtctgtggacgttctcgccgctcgatttcattccgcattgcgcg
atcgacaacgcgcacgcggcgagcacgccgatcgtgctgaccgcggatctcgagcgcgcg
ccgcatcacgggatcctgctgaacctgggcgcgcaggtgccggcgcagttcgcacgcttc
gagcgcctgctcgaggtggtcggcaacgcgcccgacgagctcgcggccggccgcgaccgg
tatcggttctatcgcgatcgcggctacgcgctcaacaatcacaagcagggcggctag

DBGET integrated database retrieval system