KEGG   Burkholderia pseudomallei 668: BURPS668_1072Help
Entry
BURPS668_1072     CDS       T00481                                 

Definition
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bpd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:1050687..1052666
Genome map
AA seq 659 aa AA seqDB search
MAGAPRTFTAVLTRPDGQSAALAAQLAAAGIDVLDFPLIDIAPLADDAPLAEAFARLDAY
ALVVFVSPNAVDHALARLGAIWPHPLPIGVVGPGSVAALARHGIAAPAHRVIAPSAPDDG
GEPHYDSESLFAEIARAFDGEAKLAGKRVLIVRGDGGREWLAERLREAGAEVELVAAYRR
VSPEPSIGAWERVHALLSGAPHAWLVTSSEGVRNLQELAHEHLNETEIDALKHARFVAPH
SRIVETARALGFDRITLTGAGDERIVRAFRTLADQADQPATAAPMPSRMTDTNDTKDVSS
KPAAAPVAPPNQPFTPFETKERRGAASAALWFVVVVIAAAAGVGGYALNRKVDRLDQHAT
ERQKALDAQTAELRTKTEQALASVRQADSQLSQLEGKLADAQTAQTALQQQYQDLSRNRD
AWMIEEVGQMLSSASQQLLLTGNTQLALIALQNADARLASSQSAQAVVVRKAIAQDIERL
KAAPSADLTGLAIKLDDAIAKVDTLPLAGEVLAPHAQAKPDAAASARQAAAAAGEPRWKA
WWRGFSAGIGEQLKSLVEVRRIDHADAMLASPEQGYFVRENVKLRLLSARLSLLARDDGA
MKSDLHAAQAAVARYFDGASKDTRVVQDLLKQVDAASLTVAVPNLNTSLNAVQQFKSRG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcgccgcgcacgttcaccgcggtgctcacgcgccccgacggacagtcggcg
gcgctcgcggcgcagctcgcggcggcgggcatcgacgtgctcgactttccgctcatcgac
atcgcgccgctcgccgacgacgcgccgctcgccgaagcgttcgcgcggctcgacgcgtat
gcgctcgtcgtgttcgtgtcgccgaacgcggtcgatcacgcgctcgcgcggctcggcgcg
atctggccgcatccgctgccgatcggcgtcgtcgggccgggcagcgtcgccgcgctcgcg
cggcacggcatcgccgcgcccgcgcatcgcgtgatcgcgccgagcgcgcccgacgacggc
ggcgagccgcactacgattccgagagcctgttcgccgagatcgcgcgtgcgttcgacggc
gaggcgaagctcgccggcaagcgcgtgctgatcgtgcgcggcgacggcggccgcgaatgg
cttgccgagcgcctgcgcgaggcgggcgccgaagtcgagctcgtcgccgcgtatcggcgc
gtgagcccggagccttcgatcggcgcgtgggagcgcgtgcacgcgctgctgtcgggcgcg
ccgcacgcgtggctcgtgacgagctcggagggcgtgcgcaatctgcaggagctcgcgcac
gagcatttgaacgaaacggagatcgacgcgctcaagcacgcccggttcgtcgcgccgcat
tcgaggatcgtcgagaccgcgcgcgcactcggttttgataggattacgctgaccggcgcg
ggcgatgagcgcatcgtccgcgcgtttcgtacgttggccgaccaggccgatcaaccggcg
acagccgcaccgatgccttctcgcatgacagacaccaacgataccaaagacgtctcttcc
aaaccggccgcggctcccgttgcgccgccgaatcaaccgtttacgccgtttgaaacgaag
gagcggcgcggcgcggcgagcgcggcgctctggttcgtggtcgtcgtgatcgcggccgcg
gcgggcgtcggcggctatgcgctgaaccgcaaggtcgaccgcctcgatcagcacgcgacc
gagcggcaaaaggcgctcgacgcgcaaacggccgagctccgcacgaagaccgaacaggcg
ctcgcgagcgtgcgccaggccgattcgcaactgtcgcagctcgaaggcaagctcgccgac
gcgcagaccgcgcagaccgcgctgcagcagcaatatcaggatctgtcgcgcaaccgcgac
gcgtggatgatcgaggaagtcggtcagatgctgtcgagcgcgagccagcaactgctgctc
acgggcaacacgcagctcgcgctgatcgcgctgcagaacgccgatgcgcggctcgcgtcg
tcgcagagcgcgcaggcggtcgtcgtgcgcaaggcgatcgcgcaggatatcgaacggttg
aaggccgcgccttcggcggatctcacggggcttgcgatcaagctcgacgacgcgatcgcg
aaggtcgacacgctgccgctcgcgggcgaagtgctcgcgccgcacgcgcaggcgaagccc
gacgccgccgcgagcgcccggcaggcggccgcggcggcgggcgagccacgctggaaggcc
tggtggcgcggcttctcggcgggcatcggcgagcagttgaagtcgctcgtcgaggtgcgc
cgcatcgatcacgcggacgcgatgctcgcgtcgcccgaacagggctacttcgtgcgcgag
aacgtgaagctgcgtctgctgagcgcgcggctgtcgctgctcgcgcgcgacgacggcgcg
atgaagtccgatctgcatgccgcgcaggcggccgtggcgcgctacttcgacggcgcatcg
aaggacacccgggtcgttcaggatctgctcaagcaggtcgacgccgcgtcgctgacggtc
gcggtgccgaacctcaacacgagcctgaacgcggttcaacagttcaagagccggggttga

DBGET integrated database retrieval system