KEGG   Burkholderia pseudomallei 668: BURPS668_1287Help
Entry
BURPS668_1287     CDS       T00481                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS668_1287 (tpiA)
   01230 Biosynthesis of amino acids
    BURPS668_1287 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS668_1287 (tpiA)
   00051 Fructose and mannose metabolism
    BURPS668_1287 (tpiA)
   00562 Inositol phosphate metabolism
    BURPS668_1287 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BURPS668_1287 (tpiA)
Enzymes [BR:bpd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BURPS668_1287 (tpiA)
Exosome [BR:bpd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BURPS668_1287 (tpiA)
  Exosomal proteins of bladder cancer cells
   BURPS668_1287 (tpiA)
  Exosomal proteins of melanoma cells
   BURPS668_1287 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1258937..1259737
Genome map
AA seq 266 aa AA seqDB search
MNTTPGFGASTTRQTMSKQRIKRVIGNWKMHGRLSGNEALLDEVAQGAQAVPEHVGIGVC
VPFPYLAQARARLHGGRVAWGAQDVSAHEQGAFTGEVAAGMVAEFGAAYAIVGHSERRAY
HGESNEIVAAKAQRALAVGLTPVVCVGETLAEREAGATERVVGVQLDAVLAVLSQDEAAR
IVVAYEPVWAIGTGRSATAEQAQQVHAFLRGRLAAKGAERVSLLYGGSVKADNAAELFGQ
PDIDGGLIGGASLKSGDFLAICRAAQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgacgcccggcttcggcgcgtccacgacgagacaaacgatgtcgaaacaaaga
atcaagcgggtgatcggcaactggaagatgcacggtcgcctgagcggcaacgaggcgctg
ctcgacgaagtcgcgcagggcgcgcaagccgtgcccgagcacgtcggcatcggcgtgtgc
gtgccgtttccgtatctcgcgcaggcgcgggcccggcttcacggcggtcgcgtcgcgtgg
ggcgcgcaggacgtgtccgcgcacgagcagggcgcctttaccggcgaagtcgcggccggc
atggtcgcggagttcggcgcggcgtacgcgatcgtcgggcactcggagcgccgcgcgtat
cacggcgaatcgaacgagatcgtcgcggcgaaggcgcaacgtgcgctcgccgtggggctg
acgcccgtcgtgtgcgtcggcgagacgctcgccgagcgcgaagcgggcgcgaccgagcgg
gtcgtcggcgtgcagctcgacgcggtgctcgcggtgctgtcgcaggacgaggcggcgcgc
atcgtcgtcgcgtacgagcccgtatgggcgatcggcacgggccgcagcgcgacggcggag
caggcgcagcaggtgcacgcgttcctgcgcgggcggctcgcggcgaagggcgccgagcgc
gtgtcgctgctgtatggcggcagcgtgaaggccgacaacgcggccgagctgttcggccag
cctgacatcgacggcggcctgatcggcggcgcgtcgttgaagagcggggatttcctggcg
atttgccgggcggcgcagtaa

DBGET integrated database retrieval system