KEGG   Burkholderia pseudomallei 668: BURPS668_1483Help
Entry
BURPS668_1483     CDS       T00481                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BURPS668_1483 (folP)
Enzymes [BR:bpd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BURPS668_1483 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:1447662..1448552
Genome map
AA seq 296 aa AA seqDB search
MSSSDFVFPVPAPLQCGRFTLTFERPLVMGILNVTPDSFSDGGRYVARDAALAQAERMLA
EGADILDIGGESTRPGAPPVPLNEELERVIPLVEALRGRNVPLSIDTYKPAVMRASLAAG
ADLINDIWGLRQPGAIDAVRDSACGLCVMHMLGEPRTMQVHAPEYRDVIDDVRAFLAERA
DALVQAGIDARRISVDPGFGFGKSVIEHNYALLAHLPRTAPARPDGRAYPILAGMSRKSM
LGAVIGRPAPERIAASVAAAVCAAERGAAIVRVHDVAATVDALKVWSAVRDAARRT
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagttccgatttcgtttttcccgttcccgcgccgctgcaatgcggccgtttcacc
ttgaccttcgagcgccccctcgtgatggggatcctcaacgtcactcccgattcgttctcc
gacggcggccgttacgtcgcccgtgacgccgcgctcgcgcaggcggagcggatgcttgcc
gaaggcgcggacatcctcgacatcggcggcgaatcgacgcgccccggcgcgccgcccgtg
ccgcttaacgaggagctcgagcgcgtgattccgctcgtcgaggcgctgcgcggccggaac
gtgccgctgtcgatcgacacgtacaagcccgccgtgatgcgcgcgtcgctcgccgcaggc
gctgatctgatcaacgatatctgggggctgcggcagccgggcgcgatcgacgcggtgcgc
gacagtgcgtgcggcctctgcgtgatgcacatgctcggcgagccgcggacgatgcaggtg
catgcgcccgagtatcgcgacgtgatcgacgacgtgcgcgcgtttctcgccgagcgcgcc
gatgcgctcgtgcaggcgggcatcgatgcccggcgtatcagcgtcgatccggggttcggt
ttcggcaagtcggtgatagaacataactacgcgctgcttgcgcatttgccgaggaccgcg
cccgcgcggcccgacgggcgcgcgtatccgatcctcgccggcatgtcgcgcaagtcgatg
ctgggcgcggtgatcggcagacccgcgcccgagcgcatcgcggcgagcgtcgcggcggcg
gtctgcgcggccgagcggggggcggcgatcgtgcgcgtgcacgacgtcgcggcgaccgtc
gacgcattgaaagtatggagcgccgtgcgtgatgccgcgcggcgaacataa

DBGET integrated database retrieval system