KEGG   Burkholderia pseudomallei 668: BURPS668_1509Help
Entry
BURPS668_1509     CDS       T00481                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS668_1509
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS668_1509
   00620 Pyruvate metabolism
    BURPS668_1509
   00640 Propanoate metabolism
    BURPS668_1509
  Energy metabolism
   00680 Methane metabolism
    BURPS668_1509
Enzymes [BR:bpd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BURPS668_1509
Lipid biosynthesis proteins [BR:bpd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BURPS668_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(1471304..1472971)
Genome map
AA seq 555 aa AA seqDB search
MHRNGIRKNDRRRTMLPHAAHYAELVERFAWRVPAHYNIGVDACDKWADGSGRLALIHEH
AHGVVARYTFDELRSSSNRLANSFARAGVKRGDRIGILLAQGPETAIAHLAAYKLGAIAV
PLFTLFGADALEFRLGDSGAVALVTDRAGYEKIAPLHASLPSLATIYCIDGAPDLAEPGV
LAFDAALAAESDTFRPADTSADDPALIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSQNL
FPARARLFWTPADWAWIGGLLDVLLPSLHHGVPVLARRFEKFDGAAAFDLLARHGVTHAF
LPPTALKLMRAAVARPHERYALALESVASGGESLGAELVSWGRDAFGVTINEFYGQTECN
VVLSSCSALFEPRAGTIGKAAPGHRVAIVDDAGNALPPGVTGNIGVRAPDPVMFIGYWRR
LEATREKFAGDFLLTGDLGIADADGFIRFVGRNDDVITSAGYRIGPGPIEDCLLEHPAVR
MAAVVGVPDAVRTEIVKAFVVLNAGYEGSAALARELQTHVKTRLAAHEYPRALAFVDSLP
MTATGKIIRRALRDI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcgaaacggcatacgaaaaaacgaccggagacgcacgatgctgccccacgccgcc
cattacgccgagctcgtcgagcgcttcgcctggcgggttcccgcgcactacaacatcggc
gtcgacgcgtgcgacaaatgggccgatggcagcggccgcctcgccctgatccacgaacac
gcgcacggcgtcgtcgcacgttacacgttcgacgaactgaggagcagctctaatcgactc
gcgaacagcttcgcgcgcgcaggcgtgaagcgcggcgaccgcatcggcatcctcctcgcg
caaggcccggaaacggcgatcgcccatctggccgcatacaagctcggcgcgatcgcggtg
ccgctcttcacactcttcggcgcggacgcgctcgaattccgcctcggcgatagcggcgcc
gtcgcgctcgtcaccgatcgcgccggttacgagaaaatcgcgccgctgcatgcgtcgctg
ccgtcgctcgcgacgatctactgcatcgacggcgcgcccgatctcgccgagcccggcgtg
ctcgcgttcgatgcggcgctcgcggccgaatcggacacgttccggcctgcggacacgtcg
gccgacgatccggcgctcatcatctacacgtccggcacgacgggcaaaccaaagggcgcg
ctgcacgcgcatcgggtgctgctcggccatctgcccggcgtcgagatgtcgcagaacctg
tttccggcgcgtgcgcgcctgttctggacgcccgccgattgggcatggatcggcgggctg
ctcgacgtcctgctgccgtcgctgcaccacggcgtgccggtcctcgcgcgacgcttcgag
aaattcgacggcgcggccgcgttcgatctgctcgcccggcacggcgtgacgcacgcgttc
ctgccgccgaccgcgctgaagctgatgcgcgcggctgtcgcgcggccgcatgaacgttac
gcgctcgcgctcgaatcggtagcgagcggcggcgaatcgctcggcgccgaactcgtttcc
tggggccgcgacgcgttcggcgtgacgatcaacgagttctacggacagaccgaatgcaac
gtcgtgctgtcgtcgtgcagcgcgctgttcgagccgcgcgcggggacgatcggcaaggcg
gcgcccgggcatcgcgtcgcgatcgtcgacgatgccggcaacgcgctgccgcccggcgtc
acgggcaacatcggcgtgcgcgcgcccgaccccgtgatgttcatcggctactggcgcagg
ctcgaggcgacgcgcgagaagttcgccggcgacttcctgctgacgggcgacctcggcatc
gccgacgccgacggtttcatccgcttcgtcggccgcaacgacgacgtgatcacgagcgcc
ggctaccggatcggcccgggaccgatcgaggattgcctgctcgagcatccggcggtgcgg
atggcggccgtcgtcggcgtgccggacgcggtccgcaccgaaatcgtcaaggcgttcgtc
gtgctgaacgccggctatgaaggaagcgccgcgctcgcccgcgagctgcaaacgcacgtg
aagacacggctcgccgcacacgaatatccgcgtgcgctcgccttcgtcgacagcctgccg
atgaccgcgaccggcaagatcatccgccgcgcgctgcgcgacatctga

DBGET integrated database retrieval system