KEGG   Burkholderia pseudomallei 668: BURPS668_1540Help
Entry
BURPS668_1540     CDS       T00481                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BURPS668_1540 (malQ)
Enzymes [BR:bpd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BURPS668_1540 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1501735..1503963)
Genome map
AA seq 742 aa AA seqDB search
MTADPRHPSIVELADAAGLDAHWIDASGFARRVGDDMLAALLDALGYPCDTRAARAESAA
RLAAHAQAAPRLVTGDVDAPLTLPASLGRPGACYRVTLENGDAVAGRFAQPAGAAVLPPL
ATPGYHVLDTGEQRATLAIAPPSAWTPADAMRAAAAGGRERPPPWGLAAQLYGLRREADG
GIGDFTALAACARAAARRGAHALAISPTQAAFPALPERDSPYSPSSRLWRNAAYIDVETV
LGAHAARAAIADAGLAAQWSALTRAPLVDWPGAVPAKLRVLRLLFDRWRAQAPTGADAGP
RAFARFRARHAGALDAHATFDALQACCIDNGIGADWRRWPPAWRTPDAPDVAAFARAHAD
DIAFHAFLQWQAARGLAAAQRAARGRGMAIGLIADLPVGCDAAGSDAWRDGDAMLRGLSI
GAPADPFNARGQAWGVTTWTPTALRARGFAPFVECLRAGFAHAGGVRIDHVLGLARLWVV
RDGAPPRDGAYLRYPRGDLLRLAALESFRHRAIVIGEDLGTVPADFRARIAARGIVGLRA
LWFERDPAGAFRAPGDWDRHAAATSSTHDLPTVAGWWRGVDLGWRWRAAASASACAPASP
LAPASDAEAEAEANAPPARPGESEVAGPDALPPEVRDMRRAERAALWRALQQAGVAARGQ
KMPPRDAPPVGAILAYVAQAPAPLAIFPLEDLLALEGQPNVPGPPCGHPNWRRRMPRSVD
ALFDAPARTRIAAVRRARKRAR
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgatccgcgtcatccgtcgatcgtcgagctcgcggacgcggccgggctcgac
gcgcactggatcgacgcatcgggcttcgcgcggcgggtcggcgacgacatgctcgcggcg
ttgctcgacgcgctcggctacccgtgcgacacgcgcgcggcgcgcgccgagagcgccgcg
cggctcgcggcgcacgcgcaggccgcgccgcggctcgtgacgggcgacgtcgacgcgccg
ctcacgctgcccgcctcgctcggacgccccggcgcgtgctaccgggtcaccctcgaaaac
ggcgacgccgtcgccggccgcttcgcgcagcccgccggcgcagccgtgctgccgccgctc
gcgacgcccggctaccacgtgctcgacaccggcgagcagcgcgcaacgctcgccatcgcg
ccgccatccgcatggacgcccgccgacgcgatgcgcgccgcggcggccggcggccgcgaa
cgcccgccgccgtggggcctcgcggcgcaactctacgggctgcgccgcgaggccgacggc
ggcatcggcgatttcaccgcgcttgccgcctgcgcgcgcgccgccgcccggcgcggcgcg
cacgcgctcgcgatcagcccgacgcaggcggccttccccgcgctgcccgagcgcgacagc
ccgtactcgccttcgtcgcggctttggcgcaacgccgcctacatcgacgtcgaaacggtg
ctcggcgcgcacgcggcgcgcgcggcgatcgccgatgcggggctcgccgcgcaatggagc
gcgctcacgcgcgcgccgctcgtcgattggcccggcgcggtgccggcgaagctgcgcgtg
ctgcgcctgctgttcgaccgctggcgcgcgcaggcgcccacgggcgcggatgcgggcccg
cgggcgttcgcgcgctttcgggcacggcacgccggcgcgctcgacgcacatgcgacgttc
gacgcgttgcaggcgtgctgcatcgacaacggcatcggcgcggactggcggcgttggccg
cccgcatggcgcacgcccgatgcgccggacgtcgccgcgttcgcgcgcgcgcacgcggac
gacatcgcgttccacgccttcctgcaatggcaggccgcgcgcgggctcgcggccgcgcaa
cgcgccgcgcgcggccgcggcatggcgatcggcctgatcgcggacttgccggtcggctgc
gacgcggcgggcagcgacgcgtggcgggatggcgatgcgatgctgcgcggcctgtcgatc
ggcgcgcccgccgatccgttcaacgcgcgcggccaggcatggggcgtcaccacgtggacg
ccgacggcgctgcgcgcgcggggcttcgcgccgttcgtcgaatgtctgcgcgcgggcttc
gcgcacgcgggaggcgttcgcatcgatcacgtgctcggcctcgcgcggctgtgggtggtg
cgcgacggcgcgccgccgcgcgacggcgcgtacctgcgctatccgcgcggcgatttgctg
cggctcgccgcgctcgaatcgttccggcatcgcgcgatcgtcatcggcgaggatctcggc
accgtgccggcggatttccgcgcgcggatcgccgcgcgcggcatcgtcggcctgcgcgcg
ctctggttcgaacgggacccggcgggcgcgttccgcgcgccgggcgattgggatcgtcac
gcggccgcgacgagctcgacgcacgatctgccgacggtcgcgggctggtggcgcggcgtc
gatctcggctggcgatggcgcgcggccgcctccgcctcggcctgcgcgcccgcgtccccc
ctcgctcccgcctccgacgccgaggccgaggccgaggcgaacgccccgcccgcgcggccc
ggcgaatcggaggtcgccgggccggatgcgctgccgcccgaggtgcgcgacatgcgccgc
gccgagcgcgcggcgctctggcgcgcgctgcagcaagccggcgtcgccgcgcgcgggcaa
aagatgccgccgcgggatgcgccccccgtcggtgcgatactcgcgtacgtcgcgcaagcg
cccgcgccgctcgcgatctttccgctcgaggatctgctcgcgctcgagggtcagccgaac
gtgccgggcccgccgtgcgggcacccgaactggcggcggcgcatgccgcgctccgtcgac
gcgctgttcgacgcgccggcgcgcacgcgcatcgccgccgtgcggcgcgcgaggaagcgc
gcgcgatga

DBGET integrated database retrieval system