KEGG   Burkholderia pseudomallei 668: BURPS668_1574Help
Entry
BURPS668_1574     CDS       T00481                                 

Definition
hypothetical protein
Organism
bpd  Burkholderia pseudomallei 668
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1538999..1539835
Genome map
AA seq 278 aa AA seqDB search
MTMERLYRGMDRATLDRAYDNTRAVADFPAVLADFRRRSAQLYARVDGRREVRYGERPRE
RFDWLSCGRAGAPRFVFIHGGYWQNCAKEDFAFVADGPLAAGFDVVLAEYTLAPEASMTQ
IVGEIARLLDRLSADRDGLGGAGRPLCLSGHSAGGHLSAVHRGHACVTSTLAISPLVDLE
PISLSWLNDKLRLSEREIADYSPLFHVGKGAPTIVAVGAHELPELVRHADDYAHACAAAG
EPVRRVHVPGRTHFSVLEELAQPDGALTRLLGAFVGGA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggaacgactgtatcgcggcatggatcgcgcgacgctcgaccgcgcgtacgac
aacacgcgggccgtagcggattttccggcggtgttggccgattttcgccggcgcagcgcg
caactgtacgcgcgcgttgacggccggcgcgaggtgcgatacggcgagcggccgcgcgag
cgtttcgactggctttcctgcggccgcgccggtgcgccgcgcttcgtcttcattcacggc
ggttactggcaaaactgcgcgaaggaggatttcgcgttcgtggccgacggcccgctcgcc
gcgggattcgacgtcgtgctcgccgaatacacgctcgcgcccgaggcgtcgatgacgcag
atcgtcggcgagatcgcccgcctgctcgatcggctgagcgccgatcgcgacgggctcggc
ggcgcggggcggccgctgtgcctgagcgggcactcggcgggcgggcatctgagcgccgtg
catcgcggccatgcgtgcgtgacgagcacgcttgcgatcagcccgctcgtcgatctcgaa
ccgatcagcctgtcgtggctcaacgacaaattgcggctgagcgagcgcgagatcgccgat
tacagcccgttgttccatgtcggcaagggcgcgccgacgatcgtcgcggtcggtgcgcac
gagctgccggagctcgtgcgccacgcggacgactacgcgcacgcatgcgcggcggcgggc
gagccggtgcggcgcgtgcacgtgccggggcgcacgcatttctccgtgctggaggaactg
gcgcagccggacggcgcgctgacgcgcctgctcggggcgttcgtcggcggcgcttga

DBGET integrated database retrieval system