KEGG   Burkholderia pseudomallei 668: BURPS668_1628Help
Entry
BURPS668_1628     CDS       T00481                                 

Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bpd  Burkholderia pseudomallei 668
Brite
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BURPS668_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1592742..1594148
Genome map
AA seq 468 aa AA seqDB search
MMRRLPRYARQHRSFFVAPRAFAAAAALAAGVAACDANGPGASAAAAVAPAALAVPAASA
ASAARPAPLAQPAAPAVVDSQPQTRAQVYEAVKQMTALGRQLFFDPSLSGSGKLACASCH
SPQHAFGPPNALPAQFGGDDLRQQGFRAVPTLKYLQKVPAFSEHYHESDDEGDESVDAGP
TGGLTWDGRVDSGAEQARAPLTSPFEMNGTPEKVARAVRAAPYAPAFRAAFGARVLDDDR
ATFEAVLQALGTFEQAPDVFYPYTSKYDAYLAGRARLTRAELHGLQVFNDEKKGNCASCH
VSRRGLDGSPPQFSDFGLIALGVPRNRALAANRNPNFYDLGACGPERRDLKGRDEFCGLF
RTPTLRNVALKKTFFHNGVYHSLDDVLRFYAERDTHPEKFYPVKRGVVQKFDDLPKRYWK
NLNDEPPFGRRRGDPPAMTDAEIRDVIAFLGTLTDGYDPRAKPAGGAR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccgcttgccgcgatacgcccgccagcaccgttcgttcttcgtcgcgccgcgc
gcgttcgcggcggccgccgcgcttgccgcgggcgtcgccgcgtgtgacgcgaacgggccg
ggcgcgagcgccgccgcggccgtcgcgcccgctgcgctcgctgtcccagccgcctccgct
gcctccgctgcgcgtcccgcgccgctcgcgcagccggccgcgcccgccgtcgtcgacagt
cagccgcagacgcgcgcgcaggtgtacgaggcggtcaagcagatgacggcgctcggcagg
cagttgttcttcgatccttcgctgtcgggcagcggcaagctcgcctgcgcgtcgtgccac
agcccgcagcacgcgttcgggccgccgaacgcgttgcccgcgcaattcggcggcgacgat
ctgcgccagcagggctttcgcgccgtgccgacgctcaagtacctgcagaaggtgcccgcg
ttcagcgagcactatcacgaatcggacgacgagggcgacgagagcgtcgacgccggcccg
acgggcgggctcacgtgggacggccgcgtggacagcggcgccgagcaggcgcgcgcgccg
ctcacgtcgccgttcgagatgaacggcacgcccgagaaggtcgcgcgcgcggtgcgggcc
gcgccgtacgcgcccgcgtttcgcgcggcgttcggcgcgcgcgtgctcgacgacgaccgc
gcgacgttcgaggcggtgctgcaggcgctcggcacgttcgagcaggcgcccgacgtgttc
tatccgtacacgagcaagtacgacgcgtacctggcgggccgcgcgcggttgacgcgcgcc
gagctgcacgggctgcaggtcttcaacgacgagaagaagggcaactgcgcgagctgccac
gtgagccggcgcgggctcgacggctcgccgccgcagttcagcgatttcggcctgatcgcg
ctcggcgtgccgcgcaatcgcgcgctcgcggcgaatcggaatccgaatttttacgacctc
ggcgcatgcgggcccgagcgccgggacctgaagggacgcgacgagttctgcgggctgttc
cgcacgccgacgctgcgtaacgtcgcgctgaaaaagacgttcttccacaacggcgtctat
cactcgctcgacgacgtgctgcgcttctacgccgagcgcgacacgcatccggagaagttc
tatccggtgaagcgcggcgtcgttcagaagttcgacgacttgccgaagcgctactggaag
aacctgaacgacgagccgccgttcgggcgcaggcgcggcgatccgcccgcgatgaccgat
gcggagatccgggacgtgatcgcgttcctcggcacgctcaccgacggctacgatccgcgc
gcgaagccggcaggcggcgcgcgctga

DBGET integrated database retrieval system