KEGG   Burkholderia pseudomallei 668: BURPS668_1630Help
Entry
BURPS668_1630     CDS       T00481                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS668_1630
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BURPS668_1630
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BURPS668_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:1595163..1597262
Genome map
AA seq 699 aa AA seqDB search
MKRRECRGNARGKDSVKMRKKSLVHLPVALAVAAALGACSGDDDATLESRADAIVERMTT
RQKVGQKLMMAFRYWCPDGQPACTTGMTEFPDAARDALRENGIGGVILFSNNLTGIEQTR
RLIDGIRAAPAADSPLGLMIGIDEEGGNVFRLPRVEATAFAGNMALGAAYEATRDDRLAY
DMGRVLAAEIAAVGFNVNFAPDVDVNSNPLNPVINVRAFGDDPATIGLLGRRMVQGMKSE
RVIGTFKHFPGHGDTDTDSHYGLPVVIKSRADAYAIDLAPYRQAIEAGEAPDMIMTAHIQ
YPSLDDTRVATRTGEQMIAPATMSRRIQHDILRGEFGYQGVTITDALDMKGIAGFFDEDD
AVVKVFQADVDIALMPVEFRTAADAGRLAALVDRVAAAVDSGRIDRAEFDRSVRRIVLTK
LRHGIVASDRGRPVDELASIGGPAHRAIERDIAQKSITVLRNENGALPLQAAGRRIFILT
PWGEQAEAMRRRFVELGHPLVTGAKLSAITWAEQQQAIDAADVVIVGTLSTGVTPVEHNG
DPNARVSPPAPSAVRMRQAAPANGEEEGSVIFDHVERADAAKDIGARPSVLAAIAAPSEA
QQMRDAMDYAKARRKTVIHVTMRAPYDVISYDDVADATLATYAYYGYEGGLRGPSLPAAV
DAMLGVGRPVGRLPVAIHALNADGSTGPLRYARGFGLQY
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacgtgaatgccgcgggaatgcgcgcggcaaggattcggtgaagatgcgcaag
aaaagcttggttcatttgcccgtcgcgctggcggtggccgcggcgctcggcgcgtgctcg
ggcgacgacgacgcgacgctcgagtcgcgcgcggacgcgatcgtcgaacgcatgacgacc
cggcagaaggtcggccagaaactgatgatggcgttccggtactggtgccccgacgggcag
cccgcgtgcacgaccggcatgaccgaatttcccgacgccgcgcgcgacgcgctgcgcgag
aacggcattggcggcgtgatcctgttctcgaacaacctgacgggcatcgagcagacgcgc
cggctgatcgacggcattcgggccgcgcccgcggccgacagcccgctcgggctgatgatc
ggcatcgacgaggagggcggcaacgtgtttcgcctgccgcgcgtcgaggcgaccgcgttc
gccggcaacatggcgctcggcgcggcgtacgaagcgacgcgggacgaccggctcgcgtac
gacatgggccgcgtgctcgccgcggagatcgcggcggtcggcttcaacgtgaatttcgcg
ccggacgtcgacgtcaacagcaatccgctcaatccggtgatcaacgtgcgcgcgttcggc
gacgatccggcgacgatcggcctgctcggccggcgcatggtgcagggcatgaagagcgag
cgcgtgatcggcacgttcaagcattttcccgggcacggcgacacggataccgattcgcac
tacggattgcccgtcgtgatcaagtcgcgcgccgacgcctacgcgatcgatctcgcgccg
taccggcaggcgatcgaagcgggcgaggcgcccgacatgatcatgaccgcgcacatccag
tatccgtcgctcgacgacacccgcgtcgcgacccgtacgggcgagcagatgatcgcgccc
gcgacgatgtcgcggcgcatccagcacgatatcctgcgcggcgagttcggctatcagggc
gtgacgatcaccgacgcgctcgacatgaagggcatcgccggcttcttcgacgaggacgac
gcggtcgtcaaggtgttccaggcggacgtcgacattgcgctgatgcccgtcgagtttcgc
accgcggccgatgccgggcgcctggcggcgctcgtcgatcgcgtcgccgcggcggtcgat
tcggggcggatcgatcgcgccgagttcgatcgctcggtgcgccgtatcgtgctgacgaag
ctgcgccacggcatcgtcgcgtcggatcgcggccggccggtcgacgagctggcatcgatc
ggcgggcccgcgcaccgcgcgatcgagcgcgacatcgcgcaaaaatcgatcaccgtgctg
cgcaacgagaacggcgcgctgccgctgcaggccgcgggccggcgcatcttcatcctgacg
ccgtggggcgagcaggccgaggcgatgcggcggcgtttcgtcgagcttggccatccgctc
gtcacgggcgcgaagctgagcgcgatcacgtgggccgaacagcagcaggcgatcgatgcg
gccgacgtcgtgatcgtcggcacgctgtcgacgggcgtgacgcccgtcgagcacaacggg
gatccgaacgcgcgcgtgagcccgccggcgccgtcggccgtgcggatgcggcaggccgcg
cccgcgaacggcgaggaggagggttcggtgatcttcgaccacgtcgagcgggcggacgcg
gcgaaggacatcggcgcgcgcccgagcgtgctcgcggcgatcgcggcgccgagcgaggcg
cagcagatgcgcgacgcgatggactacgcgaaggcgcggcgcaagaccgtgatccacgtg
acgatgcgcgcgccgtacgacgtgatcagctacgacgatgtcgcggacgcgacgctcgcc
acctacgcgtactacggctacgaaggcggcttgcgcggcccgtcgctgcccgcggccgtc
gacgcgatgctcggcgtcgggcggccggtcggcaggctgccggtcgcgatccacgcgctg
aacgcggacggatcgacggggccgctgcgctacgcgcgcggattcgggttgcagtactga

DBGET integrated database retrieval system