KEGG   Burkholderia pseudomallei 668: BURPS668_1940Help
Entry
BURPS668_1940     CDS       T00481                                 

Definition
magnesium chelatase subunit ChII (EC:4.99.1.-)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BURPS668_1940
Enzymes [BR:bpd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BURPS668_1940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:1918738..1920021
Genome map
AA seq 427 aa AA seqDB search
MNPTNEAGAATAAASDDRALPAAYPFSALIGQAALQQALLLVAVDPGLGGVLVSGPRGTA
KSTAARALAELLPEGRFVTLPLSASDEQVTGSLDLASALADNTVRFSPGLVARAHLGVLY
VDEINLLPDALVDALLDAAASGVNTVERDGVSHSHAARFALVGTMNPEEGELRPQLLDRF
GLMVELANCYDAATRQRIVKARLAFDLDPHGFRAQYRDAQAALVAQIRAARAALPALAFD
DAAHARVAELCIGAAVDGLRGDLVMLRAARALAALDGAARVAAAHVERVAADVLRHRRTR
FEPQPEFQPGFQPGSQAGPQPMGRREPPPASRSAGGDAPGGRADPGEAEATRAPTPRDAL
PGGASGPAHPAARAPSDAQRRAADERGAARDGGRGPAADDSDWGYLPPEPAGIAPVKGVI
PLPLKKR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaacccaacgaacgaagccggcgcggcaacggccgccgcctccgacgaccgcgcattg
ccggccgcctatccgttttccgcgctgatcggccaggcggcgttgcagcaggcgctgctg
ctcgtcgccgtcgatccgggcctgggcggcgtgctcgtgagcggtccgcgcggcaccgcg
aaatcgaccgccgcgcgcgcgctcgccgagctgctgcccgaggggcgcttcgtcacgcta
ccgctgtcggccagcgacgagcaggtgacgggttcgctcgacctcgcgagcgcgctcgcc
gacaatacggtgcgcttttcgcccggcctcgtcgcgcgcgcgcatctcggcgtgctgtac
gtcgacgagatcaacctgctgccggacgcgctcgtcgacgcgttgctcgacgcggccgcg
agcggcgtcaacacggtcgagcgcgacggcgtgtcgcacagccacgcggcgcgcttcgcg
ctcgtcggcacgatgaacccggaagagggcgagttgcgcccgcaactgctcgaccgtttc
gggctgatggtggagctcgcgaactgctacgacgcggcgacgcggcagcggatcgtcaag
gcgcggctcgcgttcgatctcgatccgcacggctttcgcgcgcagtaccgcgacgcgcag
gcggcgctcgtcgcgcaaattcgcgcggcgcgcgccgcgctgccggcgctcgcgttcgac
gacgccgcgcacgcgcgcgtcgccgagctgtgcatcggcgcggccgtcgacggcctgcgc
ggcgacctcgtgatgctgcgcgccgcgcgggcgctcgcggcgctcgacggggcggcgcgc
gtcgccgcggcgcacgtcgagcgcgtcgccgccgatgtgctgcgccatcggcgcacgcgg
ttcgagccgcaacctgaatttcagcccggatttcaacccgggtctcaagccgggcctcag
ccgatggggcgacgcgagcctccgcccgcatcgcgttcggccggcggcgacgcgccgggc
gggcgcgcggatccgggcgaagccgaagccacgcgcgcgcccacgcctcgcgacgcgctg
cccggcggcgcgagcggaccggcgcatcccgctgcgcgcgcgccgtccgacgcgcagcgg
cgcgcggcggacgagcgcggcgcggcgcgcgacggcggccgtgggccggccgccgacgat
agcgactggggctatctgccgcccgagccggcgggcatcgcgcccgtcaagggcgtgatc
ccgctgccgctaaaaaaacgctga

DBGET integrated database retrieval system