KEGG   Burkholderia pseudomallei 668: BURPS668_2060Help
Entry
BURPS668_2060     CDS       T00481                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bpd00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:2050722..2052803
Genome map
AA seq 693 aa AA seqDB search
MSQCGANRHRPARITGIESGNGPLPGVENESMSENVMANSKENTEAAAAPQDARRRRFLA
SSAVAGLAGASLSLGLAGCNKGGDAPAAASGAGAGAGAASGAAAAPAIDFGKYEVHPGKL
DTYYTFSSGGHSGDIRVHGLPSGREIRRIPVYNIDCMSGWGITNESRKIIGTKANGQLEY
FTGDTHHVHMSYTDGTYDGKYIFVNDKINARIARVRLDTMECDAITPLPNVQGFHGIFPD
KRDPLDQTINYTTRVFCGNEFHIPHPNDGRDLNDPKKYYCLFTCVDAKTMQPRWQVKIDG
NMDLVATSYDGKLACSNQYNTENGVHYEEMMAAERDACVFFNVARIEEAVKNGKFFKVGN
SPVPVVDGTRAANADPKTALTCYVSVPKNPHGVNASPDGKYYACSGKLSPTATLISHELM
LKWFAGELKEPRDAVVAEPEIGLGPLHTGFDGKGYAYTTLFLDSQIVKWSLEEAIKAYKG
EKAAKVVVDRIDVHYQPGHGFTSMGETKEPDGQFFISDNKFSKDRYLPVGPLHPDSAQLI
DISGEKMLLVADHPTYPEPHDSIVVRRDIIKTRQIYNLDEFPLAVKNAKDSRVERHGRKV
TVYLTSQAPTFGLREWTVKKGDEVTIILTNLDKVEDLTHGFAIPFYNINFVVHPQQTQSV
TFIADKPGVFWCFCTNFCHALHLEMRSRMLVEA
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcaatgcggcgcaaatcgtcaccggccagcccggattaccggcatcgaaagcggg
aacgggccgttgcccggcgtggaaaacgaatcaatgagtgagaatgtgatggctaattcg
aaggaaaacaccgaagcggcggcagcgccgcaggacgcgcggcggcgcaggttcctcgcc
tcgtcggcggtcgcggggctcgcgggcgcgagcctgtcgctcggcctcgcgggctgcaac
aagggcggcgacgcgcccgccgcggcgagcggcgcgggcgcgggcgcgggcgcggcgagc
ggcgcggctgcggcccccgcgatcgacttcggcaagtacgaagtgcatccgggcaagctc
gatacgtactacacgttctcgagcggcggccattcgggcgacatccgcgtgcacggcctg
ccgtccgggcgcgagatccggcgcattcccgtctacaacatcgactgcatgtccggctgg
ggcatcacgaacgaatcgcgcaagatcatcggcaccaaggccaacggccagctcgaatac
ttcacgggcgacacgcaccacgtgcacatgtcctatacggacggcacgtacgacggcaag
tacatcttcgtgaacgacaagatcaatgcgcgcatcgcgcgcgtgcgcctcgacacgatg
gagtgcgacgcaatcacgccgctgccgaacgtgcagggctttcacggcatcttccccgac
aagcgcgatccgctcgaccagacgatcaactacacgacgcgcgtgttctgcggcaacgag
ttccacattccgcacccgaacgacggccgcgacctgaacgacccgaagaagtactactgc
ctgttcacctgcgtcgacgcgaagacgatgcagccgcgctggcaggtgaagatcgacggc
aacatggatctcgtcgcgacgtcgtatgacggcaagctcgcgtgctcgaaccagtacaac
accgagaacggcgtgcattacgaggaaatgatggcggccgagcgcgacgcgtgcgtgttc
ttcaacgtcgcgcgcatcgaggaagcggtgaagaacggcaagttcttcaaggtgggcaac
tcgcccgtgcccgtcgtcgacggcacgcgcgcggcgaacgccgatccgaagacggccctc
acctgctacgtgagcgtgccgaagaacccgcacggcgtgaacgcgtcgcccgacggcaag
tactacgcgtgctcgggcaagctctcgcccaccgcgacgctgatctcgcacgagctgatg
ctcaagtggttcgcgggcgagctcaaggagccgcgcgacgcggtggtcgcggagccggag
atcggcctcgggccgctgcataccggcttcgacggcaagggctacgcgtacacgacgctc
tttctcgacagccagatcgtcaagtggagcctcgaggaagcgatcaaggcgtacaagggc
gagaaggcggcgaaagtcgtcgtcgaccggatcgacgtgcactaccagccgggccacggc
ttcacgtcgatgggcgagacgaaggagccggacggccagttcttcatctcggacaacaag
ttctcgaaggaccgctacctgcccgtcgggccgctgcatccggacagcgcgcagttgatc
gacatcagcggcgagaagatgctgctcgtggccgaccatccgacgtatcccgagccgcac
gactcgatcgtcgtgcgccgcgacatcatcaagacacggcagatctacaacctcgacgag
ttcccgctcgcggtgaagaacgcgaaggacagccgcgtcgagcggcacggcaggaaggtc
accgtctacctgacgtcgcaggcgccgaccttcgggctgcgcgaatggaccgtgaagaaa
ggcgacgaggtcacgatcatcctgaccaacctcgacaaggtggaggacctgacgcacggc
ttcgcgatcccgttctacaacatcaacttcgtcgtgcatccgcagcagacgcagtcggtg
acgttcatcgcggacaagcccggcgtgttctggtgcttctgcacgaacttctgccacgcg
ctgcatctggagatgcgctcgcggatgctcgtcgaggcgtag

DBGET integrated database retrieval system