KEGG   Burkholderia pseudomallei 668: BURPS668_2311Help
Entry
BURPS668_2311     CDS       T00481                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BURPS668_2311
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BURPS668_2311
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BURPS668_2311
Lipid biosynthesis proteins [BR:bpd01004]
 Fatty acid synthase
  Component type
   BURPS668_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:2292387..2293067
Genome map
AA seq 226 aa AA seqDB search
MSMKRTVHWKAGATLAVVATFAGPASAATNAAPAPNADGGKPVIVVLGDSLSAEYGLPRD
TGWVALMRARLAAERIDYSVANASISGDTTSGGRARLPAVLARLKPAVVVVELGANDALR
GVPLAATEGNLREIVAQARQARAQVLLVGMYVPSNYGPDYTQKFHGVYTRLSKEMRVPLV
PFLLAGIENKPDMFQADQIHPTQAAQRQLLDNVWPALKPLLRTSSR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatgaaacgcacagttcactggaaggccggcgcgacgctcgccgtggtcgcgacg
ttcgccggcccggcatccgccgccacgaatgcagcgcccgcgccgaacgccgacggcggc
aagccggtgatcgtcgtgctcggcgacagcctgtcggccgaatacggcctgccgcgcgat
acgggctgggtcgcgctgatgcgcgcgcgcctcgcggccgagcgaatcgattatagcgtc
gcgaacgcgagcatctccggcgacacgacgagcggcggccgcgcgcggctgcccgcggtg
ctcgcacggctcaagccggccgtcgtcgtcgtcgaactcggcgcgaacgacgcgctgcgc
ggcgtgccgctcgccgcgaccgaaggcaacctgcgcgagatcgtcgcgcaggcgcggcag
gcgcgcgcgcaggtgctgctcgtcggcatgtacgtgccgtcgaactacggcccggactac
acgcaaaagttccacggcgtctacacgaggctgtccaaggagatgcgcgtaccgctcgtg
ccgttcctgctcgccggcatcgagaacaagcccgacatgttccaggccgaccagatccat
ccgacgcaggccgcgcagcgccagttgctcgacaacgtatggccggccctcaagccgctg
ctgcggacgtcatcgcgctga

DBGET integrated database retrieval system