KEGG   Burkholderia pseudomallei 668: BURPS668_2475Help
Entry
BURPS668_2475     CDS       T00481                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00620  Pyruvate metabolism
bpd00630  Glyoxylate and dicarboxylate metabolism
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
bpd01200  Carbon metabolism
Module
bpd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BURPS668_2475 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BURPS668_2475 (aceB)
Enzymes [BR:bpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BURPS668_2475 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABN85158
UniProt: A3NAY6
Position
I:2441806..2443398
Genome map
AA seq 530 aa AA seqDB search
MTTTLKLPQGMAITGEIKPGYEAILTPEALELVAKLHREFEPRRRELLAARVERTQRLDA
GERPDFLAETKSIREGDWKIAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYKLNDKIATLIVRPRGWHLDEKHVTVDG
QRVSGGVFDFALFLFHNAQELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEALGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRAKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDRAMAGVRADKARDAGDG
YDGGWVAHPGLVSLAMEEFVKVLGDKPNQIGKQRDDVQIEGKDLLDFQPEAPITEAGLRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLDDGRKVTAELV
REYAKVELANVKQVVGGDTAPYDRAAAIFEQMSTSENFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacgctgaagctgccgcaaggcatggcgatcacgggcgaaatcaagcccggc
tacgaagcgatcctcacgcccgaggcgctcgaactcgtcgcgaagctgcatcgcgagttc
gagccgcgccgccgcgagctgctcgccgcacgcgtcgagcgcacccagcgcctcgacgcc
ggcgagcgccccgacttcctcgccgaaacgaaatcgatccgcgagggcgactggaagatc
gcgccgctgcccgcggacctgcaatgccgccgcgtcgagatcacgggccccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggaccaaccagatcgacggccagatcaacctgaaggacgcagtg
cgccgcacgatctcgctcgaacagaacggcaagtcgtacaagctcaacgacaagatcgcg
acgctgatcgtgcgcccgcgcggctggcacctcgacgaaaagcacgtgacggtggacggc
cagcgcgtgtcgggcggcgtcttcgatttcgccctcttcctgttccacaacgcgcaggag
ctgatcgcgcgcggctcgggcccgtacttctatctgccgaagatggaaagccatctggag
gcgcgcctctggaacgacattttcgtcgccgcgcaggaagcgcttggcgtgccgcgcggc
acgatccgcgcgaccgtgctgatcgagacgatcctcgccgcgttcgagatggacgagatc
ctgtacgaactgcgcgaacacagctcgggcctgaacgcgggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgaccgcgatttctgcctcgccgatcgcgcgaagatc
acgatgacggtgccgttcatgcgcgcctacgcgctgctgctgctgaagacctgccacaag
cgcaacgcgcccgcgatcggcgggatgagcgcgctgatcccgatcaagaacgatccggaa
gcgaacgatcgcgccatggcgggcgtgcgcgcggacaaggcgcgcgacgccggcgacggc
tatgacggcggctgggtcgcgcacccgggcctcgtgtcgctcgcgatggaggagttcgtc
aaggtgctcggcgacaagccgaaccagatcggcaagcagcgcgacgacgtgcagatcgag
ggcaaggacctgctcgatttccagccggaagcgccgatcaccgaagccgggctgcgcaac
aacatcaacgtcggcatccactatctcggctcgtggctcgcgggcaacggctgcgtgccg
atccacaacctgatggaagacgcggcgacggccgagatctcgcgctcgcaggtctggcaa
tggatccgttcgccgaagggcacgctcgacgacggccgcaaggtcacggccgagctcgtg
cgcgagtacgcgaaggtcgagctcgcgaacgtgaagcaggttgtcggcggagataccgcg
ccgtacgatcgcgccgcggcgatcttcgagcagatgtcgacgtcggagaacttcaccgag
ttcctgacgctgccgctctacgaagagatctga

DBGET integrated database retrieval system