KEGG   Burkholderia pseudomallei 668: BURPS668_2774Help
Entry
BURPS668_2774     CDS       T00481                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS668_2774
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BURPS668_2774
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BURPS668_2774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2740645..2741673)
Genome map
AA seq 342 aa AA seqDB search
MKLPPGPVMLDVAGTTLTRDDARRLAHPHTGGVILFARHFESRAQLVALTEAIRAIRDGI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDKDVLHATKAATALGYVLASELRACGID
MSFTPVLDLDYGRSKVIGDRAFHRDPRVVALLAKSVNHGLALAGMANCGKHFPGHGFAQA
DSHVALPTDDRPLDEILANDAAPYDWLGLSLSAVIPAHVIYTQVDSKPAGFSRVWLQDVL
RGRLRFAGAVFSDDLSMEAAREGGTLAQSAQAALEAGCDMVLVCNQPDAAERVLDELRTT
ASRESSRRIKQMRPRGKALEWRKLMREPRYLNAQGLLRSTFA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccccccggtccggtgatgctcgacgtcgccggcacgacgctcacgcgcgac
gacgcgcgccgcctcgcgcatccgcacacgggcggcgtgatcctgttcgcgcgccacttc
gagagccgcgcgcaactcgtcgcgctgaccgaggcgatccgggcgatccgcgacggcatc
ctgatcgcggtcgatcacgagggcggccgcgtgcagcgctttcgcaccgacggcttcacc
gtgctgccggcgatgcgccggcttggcgagctgtgggacaaggacgtgctgcacgcgacg
aaggcggcgaccgcgctcggctatgtgctcgcgtccgagctgcgcgcgtgcggcatcgac
atgagcttcacgcccgtgctcgatctcgattacggccgctcgaaggtaatcggcgatcgc
gcgttccatcgcgatccgcgcgtcgtcgcgttgctcgcgaagagcgtcaaccacgggctc
gcgctcgccgggatggcgaactgcggcaagcattttcccggccacggcttcgcgcaggcc
gattcgcacgtcgcgctgccgaccgacgatcgtccgctcgacgagatcctcgcgaacgac
gcggcgccgtacgactggctcgggctgtcgttgtcggccgtcattccggcgcacgtgatc
tacacgcaggtcgattcgaagccggccggcttctcgcgcgtgtggttgcaggacgtgctg
cgcggccggctgcgctttgcgggcgccgtgttcagcgacgatctgtcgatggaggccgcg
cgcgagggcggcacgctcgcgcagtcggcgcaggccgcgctcgaggcgggctgcgacatg
gtgctcgtgtgcaaccagccggatgcggcggagcgggtgctcgacgagctgcgcacgacg
gcgtcgcgcgaatcgtcgcggcggatcaagcagatgcggccgcgcggcaaggcgctcgaa
tggcgcaagctgatgcgcgagccgcgctatctgaatgcgcagggcctgttgcgcagcacg
ttcgcctga

DBGET integrated database retrieval system