KEGG   Burkholderia pseudomallei 668: BURPS668_3001Help
Entry
BURPS668_3001     CDS       T00481                                 

Gene name
glk
Definition
bifunctional glucokinase/RpiR family transcriptional regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bpd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpd00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bpd00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpd00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpd00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bpd00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:2947219..2949144
Genome map
AA seq 641 aa AA seqDB search
MSTGAQTKAAAASQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIR
KYLKDAKIGRVNHAAIAIANPVDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGARRQNSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAP
MDEREDLVLQYARRKYPHVSFERVCAGPGMEIIYRALAARDKKRIAANVDTADIVERAHA
GDALALEAVECFCAILGTFAGNLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKG
RFEAYLANIPTYLITAEYPAFLGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAA
PNAELAEAMARAKARAGASAGDEAADVLDWLSHGAAPAAKD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaactaaggccgccgcggcgagccagcacgcggacgggccgcgc
ctattggccgacgtcggcggcacgaacgcgcgcttcgcgctcgagacgggcccgggagaa
atcacgcagatccgcgtgtacccgggcgccgagtatccgacgctcaccgacgcgatccgc
aagtacctgaaggacgcgaagatcggccgcgtgaatcacgcggcgatcgcgatcgcgaac
cccgtcgacggcgatcaggtccggatgacgaatcacaactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgatacgctgctcgtcgtcaacgatttcaccgcgctcgcg
atggcgctgcccggcctgaccgatgcgcagcgcgtacagatcggcggcggcgcgcgccgg
cagaacagcgtgatcggcctgatggggccgggcacggggctcggcgtgtcggggctcatt
cccgccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcgacgttcgcgccg
atggacgagcgcgaggatctcgtgctgcaatacgcgcgccgcaagtatcctcacgtgtcg
ttcgagcgcgtgtgcgcgggcccgggcatggagatcatctatcgcgcgctcgccgcgcgc
gacaagaagcgcatcgccgcgaacgtcgacacggccgacatcgtcgagcgcgcgcacgcg
ggcgatgcgctcgcgctcgaggcggtcgagtgcttctgcgcgattctcggcacgttcgcc
ggcaacctcgcggtcacgctcggcgcgttgggcggcatctatatcggcggcggcgtcgtg
ccgaagctcggcgagctgttcatgcgctcgccgtttcgcgcgcgcttcgaggcgaagggc
cgcttcgaggcgtatctcgcgaacatcccgacctacctgatcaccgcggaatacccggcg
tttctcggcgtatcggcgatcctcgccgagcaactgtcgaaccgcacgggcggcgcgtcg
tcggccgtgttcgagcgcatccgccagatgcgcgacgcgttgacgcccgccgagcggcgc
gtcgccgatctcgcgctcaaccatccgcgctcgatcatcaacgatccgatcgtcgacatc
gcgcgcaaggccgacgtgagccagcccaccgtgatccgcttctgccgctcgctcggctgc
caggggctgtcggacttcaagctgaagctcgcgacgggcctcaccggcacgatcccgatg
agccacagccaggtgcatctgggcgacaccgcgaccgatttcggcgcgaaggtgctcgac
aacacggtatcggcgatccttcagttgcgcgagcatctgaacttcgagcacgtcgagcag
gcgatcgacatcctgaacaatgcgcggcgcatcgagttctacggcctgggcaattcgaac
atcgtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtac
ggcgacctgtacatgcaggcggcgtcggccgcgctcctcggcaagggcgacgtgatcgtc
gcggtgtcgaagtcggggcgcgcgccggagctgttgcgcgtgctcgacgtcgcgatgcag
gcgggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgccaagcgcgcgacg
gtcgcgctcgagaccgatcacatcgagatgcgcgagtcgcagttgtcgatgatctcgcgg
atcctgcatctcgtgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgccgcg
ccgaacgcggagctcgcggaggcgatggcgcgcgcgaaggcgcgcgcgggcgcgagcgcg
ggcgacgaggccgccgacgtgctcgactggctgagccacggcgcggcgcccgcggcgaag
gactga

DBGET integrated database retrieval system