KEGG   Burkholderia pseudomallei 668: BURPS668_3083Help
Entry
BURPS668_3083     CDS       T00481                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase family protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00010  Glycolysis / Gluconeogenesis
bpd00030  Pentose phosphate pathway
bpd00051  Fructose and mannose metabolism
bpd00052  Galactose metabolism
bpd00230  Purine metabolism
bpd00500  Starch and sucrose metabolism
bpd00520  Amino sugar and nucleotide sugar metabolism
bpd00521  Streptomycin biosynthesis
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
bpd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS668_3083
   00030 Pentose phosphate pathway
    BURPS668_3083
   00051 Fructose and mannose metabolism
    BURPS668_3083
   00052 Galactose metabolism
    BURPS668_3083
   00500 Starch and sucrose metabolism
    BURPS668_3083
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS668_3083
  Nucleotide metabolism
   00230 Purine metabolism
    BURPS668_3083
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BURPS668_3083
Enzymes [BR:bpd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BURPS668_3083
    5.4.2.8  phosphomannomutase
     BURPS668_3083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABN83489
UniProt: A3NCM4
Position
I:complement(3023720..3025138)
Genome map
AA seq 472 aa AA seqDB search
MDDTESESMISQSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDAVVVARDGRL
SGPELVGALADGLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSCIVVTGSHNP
PDYNGFKMVLRGAAIYGDQIQGLYKRIVDARFETGNGSYERYDVADQYVERIVGDIRLAR
PLKLVVDAGNGVAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPENLQDVIAKLK
TTDAEIGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRNLA
QWVREKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLE
ILARAADPSALLNGLPNAVSTPELQLKLDEGENVKLIDKLRADAKFDGADEVVTIDGLRV
EYPDGFGLARSSNTTPVVVLRFEASSDAALARIQDDFRRALKAAKPDANLPF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggacgacacagagagtgaatcgatgatctcccaatccatcttcaaggcatacgatatt
cggggcgtgatcggcaagacgctcgacgccgacgtcgcgcgctcgatcggccgcgcattc
ggcagcgaagtgcgcgcgcagggcggcgacgcggtcgtcgtcgcgcgcgacggccggctc
tcggggcccgagctcgtcggcgcgctcgcggacgggctgcgcgcggcgggcgtcgatgtc
gtcgacgtcggcatggtgccgacgcccgtcggctacttcgcggcgagcgtgccgctcgcg
ctgtcgggcggcgagcgccgcgtcgattcgtgcatcgtcgtcacgggcagccacaatccg
cccgactacaacggtttcaagatggtcctgcgcggcgccgcgatctacggcgaccagatc
cagggcctgtacaagcgcatcgtcgacgcgcgtttcgagaccggcaacggttcgtatgag
cgatacgatgtcgccgatcaatacgtcgagcgcatcgtcggcgacatcaggctcgcgcgg
ccgctgaagctcgtcgtcgatgcgggcaacggcgtcgcgggcccactcgcgacgcgcctg
ttcaaggcgctcggctgcgaactcgtcgagctcttcaccgacatcgacggcaacttcccg
aaccaccacccggacccggcgcacccggagaacctgcaggacgtgatcgcgaagctgaag
acgaccgatgccgagatcggcttcgcgttcgacggcgacggcgaccgcctcggcgtcgtc
acgaaggacggccagatcatctatccggaccgccagctgatgctgttcgccgaggaagtg
ctgtcgcgcaacccgggcgcgcagatcatctacgacgtgaagtgcacgcgcaatctcgcg
cagtgggtgcgcgagaagggcggcgagccgctgatgtggaagacgggccactcgctcgtg
aaggcgaagctgcgcgagacgggcgcgccgctcgcgggcgagatgagcggccacgtgttc
ttcaaggatcgctggtacggcttcgacgacggcctctacacgggcgcgcgcctgctcgag
attctcgcgcgcgcggccgatccgagcgcgctgctcaacggcttgccgaacgcggtgtcg
acgcccgagctgcaactgaagctcgacgaaggcgagaacgtgaagctgatcgacaagctg
cgcgccgacgcgaagttcgacggcgcggacgaggtcgtgacgatcgacggtctgcgcgtc
gagtatccggacggcttcggtctcgcgcgttcgtcgaacacgacgcccgtggtcgtgctg
cgcttcgaggcgagctccgacgcggcgctcgcgcggatccaggacgatttccggcgcgcg
ctgaaggcggcgaagccggacgcgaacctgccgttctga

DBGET integrated database retrieval system