KEGG   Burkholderia pseudomallei 668: BURPS668_3209Help
Entry
BURPS668_3209     CDS       T00481                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00040  Pentose and glucuronate interconversions
bpd00052  Galactose metabolism
bpd00500  Starch and sucrose metabolism
bpd00520  Amino sugar and nucleotide sugar metabolism
bpd01100  Metabolic pathways
bpd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BURPS668_3209 (galU)
   00052 Galactose metabolism
    BURPS668_3209 (galU)
   00500 Starch and sucrose metabolism
    BURPS668_3209 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS668_3209 (galU)
Enzymes [BR:bpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BURPS668_3209 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABN84053
UniProt: A3NCZ9
Position
I:3140574..3141458
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLTLVRGIKPRHVDCFYVRQAEALGLGHAVLCAQK
LVGDSPFAVVLADDLLDGRPPVLRQMIDVFNHYHTSVIGVEQIAPQESKSYGVIDGKRWE
DNLFKLSGIVEKPEPAAAPSNFGVVGRYVLTPRIFDHLRALKPGAGGELQLTDALQSLLK
DEQVLAHRYDGLRFDCGSKIGYLKATVEFALRHPEVAPEFERYLSERFPELVAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcacaaaagccgtattccccgtcgccggcctcggcacccgctttttgccc
gcgacaaaagcgagtccgaaggaaatgctgccgatcgtcgacaagcccctgattcagtat
gcggtcgaggaagcgatcgccgcgggcatcaccgagatgatcttcgtcacgggccgcagc
aagcgcgccatcgaggatcatttcgacaaatcgtatgagatcgaggcggagctcgaagcc
cgcggcaaggaaaagctgctgacgctcgtgcgcggcatcaagccgcggcatgtcgattgt
ttctacgtgcgccaggccgaagcgctcgggctcggtcacgcggtgctgtgcgcgcagaag
ctcgtcggcgacagcccgttcgccgtcgtcctcgcggacgacctgctcgacgggcggccg
cccgtgctgcggcagatgatcgacgtgttcaatcactatcacacgtccgtcatcggcgtc
gagcagatcgccccgcaggagtcgaagtcgtacggcgtgatcgacggcaagcgctgggaa
gacaatctcttcaagctgtcgggcatcgtcgagaagcccgagccggccgccgcgccgtcg
aatttcggcgtcgtcggccgctacgtgctcacgccgcgcatcttcgaccatctgcgcgcg
ctcaagcccggggcgggcggcgaactacaattgaccgacgcgctgcaatcgctgttgaag
gacgagcaagtgctcgcgcatcgctacgacggcctgcgcttcgattgcggcagcaagatc
ggctatttgaaggcgacggtcgagttcgcgctgcgccacccggaagtcgcccccgaattc
gaacggtatctgagcgagcgctttccggagctcgtggccgcgtga

DBGET integrated database retrieval system