KEGG   Burkholderia pseudomallei 668: BURPS668_3431Help
Entry
BURPS668_3431     CDS       T00481                                 

Gene name
tkt
Definition
transketolase (EC:2.2.1.1)
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS668_3431 (tkt)
   01230 Biosynthesis of amino acids
    BURPS668_3431 (tkt)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BURPS668_3431 (tkt)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BURPS668_3431 (tkt)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    BURPS668_3431 (tkt)
Enzymes [BR:bpd01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     BURPS668_3431 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3357089..3359179)
Genome map
AA seq 696 aa AA seqDB search
MARELRMPPVPRFLDSFSGLDMTTSSPASTTLMANAIRALAMDAVQQANSGHPGMPMGMA
EIGVALWSRHLKHNPTNPHWADRDRFVLSNGHGSMLLYSLLHLTGYDLPIEELKNFRQLH
SKTPGHPEYGITPGVETTTGPLGQGLANAVGMALGEALLAAEFNRDDAKIVDHHTYVFVG
DGCLMEGISHEACSLAGTLKLNKLIAFYDDNGISIDGDVVNWFHDDTPKRFEAYGWNVIP
NVNGHDVDAVDAAIAKAKSADKPTLICCKTVIGKGAATKAGGHDVHGAALGAEEIAKTRD
ALGWKWAPFVIPQEVYAAWDAKEAGKRREGDWNAAFAQYRAKYPAEAAEFERRMAGKLPA
DWAEKAAAIVAGANERGETVATRKASQQTIEGLAAVLPELLGGSADLTGSNLTNWKASKA
VRANAHGAGIQWGNHINYGVREFGMSAAINGLVLHGGYKPFGGTFLTFSDYSRNALRVAA
LMKVPSIFVFTHDSIGLGEDGPTHQSVEHVASLRLIPNLDVWRPADTVETAVAWTHAVSH
QHPSCLVFSRQNLAFNARTDAQLANIEKGGYVLRDWDEEIVARKIILIATGSEVELAMKA
VEPLAQQGIAVRVVSMPSTDVFDRQDAEYRERVLPHGVRRVAIEAGVTDFWRKYVGLEGG
VVGIDTFGESAPAGVLFKHFGFTIEHVVETAKAVLA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
ttggcccgcgagcttcggatgccgcccgtgccccgttttctcgactcgttctccggactc
gacatgacgacttcgtctcccgcctccaccactctgatggccaacgcgatccgcgcgctc
gcgatggacgccgtccagcaagcgaactccggccaccccggcatgccgatgggcatggcc
gagatcggcgtcgcgctgtggtcgcgccacctgaagcacaacccgacgaacccgcattgg
gccgaccgcgaccgcttcgtgctgtcgaacggccacggttcgatgctgctgtactcgctg
ctgcacctgacgggctacgatctgccgatcgaagagctgaagaatttccggcaattgcat
tcgaagacgccgggccacccggaatacgggatcacgccgggcgtcgagacgacgacgggc
ccgctcggccagggcctcgcgaacgcggtcggcatggcgctcggcgaggcgctgctcgcc
gccgagttcaaccgcgacgacgcgaagatcgtcgatcatcacacgtacgtgttcgtcggc
gacggctgcctgatggagggcatctcgcacgaggcgtgctcgctcgcgggcacgctcaag
ctcaacaagctgatcgcgttctacgacgacaacgggatctcaatcgacggcgacgtcgtc
aactggttccacgacgacacgccgaagcgcttcgaggcgtacggctggaacgtgattccg
aacgtgaacggccacgacgtcgacgcggtcgatgccgcgatcgcgaaggcgaagagcgcg
gacaagccgacgctcatctgctgcaagacggtgatcggcaagggcgcggcgacgaaggcg
ggcggccacgacgtgcacggcgcggcgctcggcgcggaggaaatcgcgaagacgcgcgac
gcgctcggctggaagtgggcgccgttcgtgattccgcaggaagtctacgcggcgtgggac
gcgaaggaagcgggcaagcgccgcgaaggcgactggaacgcggcgttcgcgcagtaccgc
gcgaagtacccggccgaggccgccgaattcgagcgccgcatggcgggcaagctgccggcc
gactgggccgagaaggccgcggcgatcgtcgccggcgcgaacgagcgcggcgagacggtc
gcgacgcgcaaggcgtcgcagcagacgatcgagggccttgccgccgtgctgcccgagctg
ctcggcggctcggccgacctgacgggctcgaacctcacgaactggaaggcgtcgaaggcg
gtgcgcgcgaatgcgcacggtgcgggcatccagtggggcaaccacatcaactacggcgtg
cgcgaattcggcatgagcgccgcgatcaacggcctcgtgctgcacggcggctacaagccg
ttcggcggcacgttcctcacgttctccgactacagccgcaacgcgctgcgcgtcgccgcg
ctgatgaaggtgccgtcgatcttcgtgttcacgcacgattcgatcggcctcggcgaagac
gggccgacgcaccagtcggtcgagcacgtcgcgagcctgcggctgattccgaacctcgac
gtctggcgcccggccgacacggtcgagacggcggtcgcgtggacccacgcggtctcgcac
cagcacccgtcgtgcctggtcttcagccgccagaacctcgcgttcaacgcgcgcaccgac
gcgcagctcgcgaacatcgagaagggcggctacgtgctgcgcgactgggacgaagagatc
gtcgcgcgcaagatcatcctgatcgcgacgggctcggaagtggagctcgcgatgaaggcg
gtcgagccgctcgcgcagcaggggatcgccgtgcgcgtcgtgtcgatgccgtcgaccgac
gtgttcgaccggcaggacgccgagtaccgcgagcgcgtgctgccgcacggcgtgcgccgc
gtcgcgatcgaagcgggcgtcaccgatttctggcgcaagtacgtgggcctcgaaggcggc
gtggtcggcatcgacacgttcggcgagtcggctccggctggcgtgttgttcaagcatttc
ggcttcacgatcgagcacgtggtcgaaacggcgaaggcggtgctcgcgtaa

DBGET integrated database retrieval system