KEGG   Burkholderia pseudomallei 668: BURPS668_3438Help
Entry
BURPS668_3438     CDS       T00481                                 

Definition
guanyl-specific ribonuclease Sa (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bpd  Burkholderia pseudomallei 668
Brite
Enzymes [BR:bpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     BURPS668_3438
Transfer RNA biogenesis [BR:bpd03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    BURPS668_3438
 Prokaryotic Type
    BURPS668_3438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(3362439..3362870)
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAIVAMGNIGATPGSLVSAAYAREAATVDGAAAQVDTIPASRLPRE
AATTLSLIAAGGPYPYGKDGAVFGNYERILPKMRRGYYHEYTVPTPRARNRGARRIVCGG
PLRRVDNCYYTGDHYNSFKRIVD
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatcgtcgcgatg
ggcaacatcggcgctacgccgggcagtctggtttccgccgcatacgcacgggaagccgcc
acggtcgacggggcggcggcgcaggtcgatacgatccccgcatcccgtttgccgcgcgag
gcagcaaccacgctcagcctgatcgccgcgggcggtccctatccgtacgggaaagacggt
gcggtattcggcaattacgaacggatcttgccgaagatgcggcgcggctattaccacgag
tacacggtgccgacgccgcgcgcccgcaatcgcggcgcgcggcgcatcgtctgcggcggc
cccttgaggcgcgtcgacaattgttattacaccggcgaccactacaacagtttcaaacgt
atcgttgattga

DBGET integrated database retrieval system