KEGG   Burkholderia pseudomallei 668: BURPS668_3564Help
Entry
BURPS668_3564     CDS       T00481                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bpd  Burkholderia pseudomallei 668
Brite
Enzymes [BR:bpd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BURPS668_3564
Secretion system [BR:bpd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BURPS668_3564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(3497446..3498174)
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGLYEV
NLGSQIVYSDASGDYVLLGELVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKGNGA
RKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTVKSKSIWCASDRVKSWQS
WMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQALAG
VK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgattcgtatcgccgcgctcgccctggctgccgcgacggcgacgctcggc
tgcaccgcgcaggccgaccagtccaccgacaagctgaaggccgcgctgcaatcgcgcctc
ggcgccgacgcgccgatcaagagcgtgacgaagtcgccgattgcgggtttgtacgaggtc
aatctcggctcgcagatcgtctatagcgacgcatcgggcgattacgtgctgctcggcgag
ctcgtcaacacgaagacgcacaagaacctcacggccgagcgcctcgccgagatcaacaag
atcgatttcgcgagcctgccgctgtcgaacgcgatcaaggtcgtgaagggcaacggcgcg
cgcaagatcgcggtgttctccgatccgaactgcccgtactgcaagaagctcgagacgacg
ctgcaatcggtcgacaacgtgaccgtctacacgttcctgtatccggtgctgtcgcccgat
tcgacggtgaagtcgaagtcgatctggtgcgcgagcgaccgcgtgaaaagctggcagtcg
tggatgctcgagcatcgcgcgcccacgagcgcggcgaactgcgacacgaccgcgctcgac
aagaacctcgcgctcggccgcggaatgaacgtgacgggcacgccgaccgtattcctcgcc
gacggcacgcgcctgccgggcgccgtatccgccgacgaactgaatcaggcgctcgccggc
gtcaagtga

DBGET integrated database retrieval system