KEGG   Burkholderia pseudomallei 668: BURPS668_3589Help
Entry
BURPS668_3589     CDS       T00481                                 

Gene name
hemA
Definition
(GenBank) glutamyl-tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00860  Porphyrin and chlorophyll metabolism
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
Module
bpd_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BURPS668_3589 (hemA)
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     BURPS668_3589 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlutR_N Shikimate_DH GlutR_dimer F420_oxidored VirB8
Motif
Other DBs
NCBI-ProteinID: ABN81561
UniProt: A3NE23
Position
I:3514757..3516061
Genome map
AA seq 434 aa AA seqDB search
MDMQLLTIGINHHTAPVALRERVAFPLEQIKPALSTFKSVFLGHPAPNAPEAAILSTCNR
TELYCATNDRAARDAAIRWMSDYHRIPADELAPHVYALPQSEAVRHAFRVASGLDSMVLG
ETQILGQMKNAVRTASEAGSLGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLA
QRIFEQVAQQRVLFIGAGEMIELCATHFAAQGPRELIVANRTAERGAKLAERFGGRAMPL
ADLPARMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLK
DVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDARSIVPVIRHMHTQAD
ALRRAEVERARKMLARGDDPDAVLDALSQALTNKLIHGPTSALNRANGADRDSLIDLMRG
FYQHAPRSSDTSDR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggacatgcagctcctcacgatcggaatcaaccaccacactgcgcctgtcgccttgcgc
gaacgcgtggcgtttccgctcgaacagatcaagcccgcattgtcgacgttcaagagcgtc
ttcctcggccatccggcgccgaacgcacccgaagcggcgatcctgtcgacctgcaatcgc
actgaactgtattgcgcgaccaacgatcgcgccgcgcgcgacgccgcgatccgctggatg
tccgactaccaccggattcccgccgacgagctcgcgccgcacgtgtacgcgctgccgcaa
tccgaggcggtgcgccacgcgtttcgcgtcgcgtccgggctcgattcgatggtgctcggc
gaaacgcagatcctcggccagatgaagaacgcggtacgcaccgcgtccgaggcgggttcg
ctcggcacctacctgaaccagctgttccagcgcacgttcgcggtcgcgaaggaagtgcgc
ggcacgaccgagatcggcgcgcagtcggtgtcgatggcggctgcggccgtgcgcctcgcg
cagcgcatcttcgagcaggtcgcgcagcagcgcgtgctgttcatcggcgcgggcgagatg
atcgagctctgcgcgacccacttcgccgcgcagggcccgcgcgagctcatcgtcgcgaac
cgcaccgccgagcgcggcgcgaagctcgccgagcgcttcggcggccgcgcgatgccgctc
gccgatctgcccgcgcgcatgcacgagttcgacatcatcgtgtcgtgcacggcatcgacg
ctgccgatcatcggtctcggcgccgtcgagcgcgcggtgaaggcgcgccgccaccggccg
atcttcatggtcgacctcgcggtgccgcgcgacatcgagcccgaagtcggcaagctgaag
gacgtgttcctctataccgtcgacgatctcggcgcgatcgtgcgcgaaggcaatgcgtcg
cggcaagcggccgtcgcgcaggccgaggcgatcatcgagacgcgcgtgcagaatttcatg
cagtggctcgacgcgcgcagcatcgtgcccgtgatccgtcacatgcatacgcaggcggac
gcgttgcgccgcgcggaagtcgagcgcgcgcgcaagatgctcgcgcgcggcgacgatccg
gacgccgtgctcgatgcgctgtcgcaagcgctcaccaacaagctgattcacggcccgacg
agcgcgctcaaccgcgcgaacggcgccgatcgcgattcgctgatcgacctgatgcgcggc
ttctaccagcacgcgccccgctcgtcggacacgtcggaccgttag

DBGET integrated database retrieval system