KEGG   Burkholderia pseudomallei 668: BURPS668_A0023Help
Entry
BURPS668_A0023    CDS       T00481                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bpd00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bpd00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(16252..17037)
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAIVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVAELIEQAGGRAIGV
AMDVTNEDAVNAGIDKVAQTFGSVDILVSNAGIQIVNPIENYAFADWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTVDGVFTTVEDVAKTVLFLS
AFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctgaatggcaaaaccgccatcgtgacgggcgcggcgagcggcatcggcaag
gaaatcgcgctggagctcgcgcgcgcgggcgcggcggtggcgatcgccgatctgaaccag
gacggcgcgaacgcggtggccgagctcatcgagcaggcgggcggccgggcgatcggcgtg
gcgatggacgtgacgaacgaggacgcggtgaacgccggcatcgacaaggtcgcccagacg
ttcggctcggtcgacattctcgtgtcgaacgcgggcatccagatcgtcaatccgatcgag
aactatgcgttcgccgactggaagaagatgcaggcgattcacgtcgacggcgcgttcctg
acgacgaaggccgcgctcaagcacatgtacaaggacgatcgcggcggggtggtgatctac
atgggctcggtgcattcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggccaag
cacgggctgctggggcttgcgcgcgtgctggcgaaggaaggcgcgaagcacaacgtgcgc
tcgcatgtggtgtgcccgggcttcgtgcgcacgccgctcgtcgacaagcagattccggag
caggccaaggagctcggcatcagcgaagaggaggtggtgaagaaggtgatgctcggccag
acggtggacggcgtgttcacgacggtcgaggacgtcgcgaagacggtgctgttcctgtcc
gcgttcccgagcgcggcgctcaccggccagtcgttcgtcgtcagccacggctggttcatg
caatga

DBGET integrated database retrieval system